BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|254040898|gb|ACT57694.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|317120685|gb|ADV02508.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] gi|317120727|gb|ADV02549.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120788|gb|ADV02609.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120829|gb|ADV02650.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] Length = 68 Score = 126 bits (317), Expect = 9e-28, Method: Composition-based stats. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT Sbjct: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 Query: 61 KGAKLSSD 68 KGAKLSSD Sbjct: 61 KGAKLSSD 68 >gi|315122558|ref|YP_004063047.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495960|gb|ADR52559.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 89.8 bits (221), Expect = 1e-16, Method: Composition-based stats. Identities = 46/71 (64%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADEPKKLNPDQ+CDA+C LT ++Q+ELQ+KV+++YEE Sbjct: 1 MKTKTFLIASTLITSGLLAGCDLADEPKKLNPDQICDAICNLTTKQQEELQSKVDKKYEE 60 Query: 58 HLTKGAKLSSD 68 HL GAK+SSD Sbjct: 61 HLKTGAKISSD 71 >gi|315122912|ref|YP_004063401.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496314|gb|ADR52913.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 89.4 bits (220), Expect = 1e-16, Method: Composition-based stats. Identities = 44/71 (61%), Positives = 56/71 (78%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIAS + + L GC LADEPKKLNPDQ+CDA+C+L L+EQ+ELQ+KV+Q+YE+ Sbjct: 1 MKTKTFLIASIIATSGLLAGCNLADEPKKLNPDQICDAICKLNLQEQQELQSKVDQKYED 60 Query: 58 HLTKGAKLSSD 68 HL G K+SSD Sbjct: 61 HLKTGTKISSD 71 >gi|315122557|ref|YP_004063046.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495959|gb|ADR52558.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 74 Score = 74.0 bits (180), Expect = 6e-12, Method: Composition-based stats. Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADE KL PDQ+CD + +LT +EQ EL K+ ++YEE Sbjct: 4 MKTKTFLIASTLITSGLLAGCDLADESNKLTPDQICDGIVKLTKKEQDELHIKLKKKYEE 63 Query: 58 HLTKGAKL 65 HL GAK+ Sbjct: 64 HLKTGAKI 71 >gi|309388934|gb|ADO76814.1| hypothetical protein Hprae_0660 [Halanaerobium praevalens DSM 2228] Length = 364 Score = 35.8 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%) Query: 3 IKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYE 56 I VL++ TL+ L GCG ++ +K P++ L+ +E+KE + ++YE Sbjct: 7 ILMVLLSITLVFLTGCGFKEKSQKPKPEEQIQTQTDLSSQERKEEIASLEEKYE 60 >gi|307180264|gb|EFN68297.1| ADP-ribosylation factor GTPase-activating protein 3 [Camponotus floridanus] Length = 524 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 39 LTLEEQKELQTKVNQRYEEHLTKGAK 64 +T EEQ+EL T++ QRYE++LT+ AK Sbjct: 271 VTKEEQEELATRLAQRYEQNLTQQAK 296 >gi|288555845|ref|YP_003427780.1| hypothetical protein BpOF4_14185 [Bacillus pseudofirmus OF4] gi|288547005|gb|ADC50888.1| hypothetical protein BpOF4_14185 [Bacillus pseudofirmus OF4] Length = 247 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Query: 9 ASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAKLSSD 68 A T LS CG +DE + DQL L L +Q E+ +V +E H+T+G L D Sbjct: 11 ALTALSACGGAESDEMEMGMDDQLTPIEVELVLPDQAEINEEV--LFESHVTQGDDLVED 68 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.315 0.131 0.371 Lambda K H 0.267 0.0405 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 517,483,947 Number of Sequences: 14124377 Number of extensions: 13744512 Number of successful extensions: 29486 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 29480 Number of HSP's gapped (non-prelim): 7 length of query: 68 length of database: 4,842,793,630 effective HSP length: 40 effective length of query: 28 effective length of database: 4,277,818,550 effective search space: 119778919400 effective search space used: 119778919400 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 75 (33.5 bits)