BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 137 bits (345), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT Sbjct: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 Query: 61 KGAKLSSD 68 KGAKLSSD Sbjct: 61 KGAKLSSD 68 >gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 28.5 bits (62), Expect = 0.024, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 22/30 (73%) Query: 22 DEPKKLNPDQLCDAVCRLTLEEQKELQTKV 51 +EP+K+ DQ+ +A+ L EE+++LQ ++ Sbjct: 23 EEPQKVTVDQINNAIASLIPEERRDLQDRM 52 >gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 25.4 bits (54), Expect = 0.18, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 25/42 (59%) Query: 19 GLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 LA+ +KL DQ+ +++ L E+++EL + ++Y + L Sbjct: 40 SLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLI 81 >gi|254781130|ref|YP_003065543.1| hypothetical protein CLIBASIA_05160 [Candidatus Liberibacter asiaticus str. psy62] Length = 378 Score = 24.3 bits (51), Expect = 0.39, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 8 IASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEH 58 I + G LA P + P L A+ L L+E KEL+ ++++ EEH Sbjct: 313 INEVFVDTIGGYLAPNPSVIIP-HLAKAIQEL-LQEVKELRDMIDKQNEEH 361 >gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 20.8 bits (42), Expect = 4.8, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 12 LLSLCGCGLADEPKK 26 + ++ GCGLA KK Sbjct: 12 MTTISGCGLASREKK 26 >gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 42 EEQKELQTKVNQRYE 56 EE+K LQTK+ YE Sbjct: 119 EERKLLQTKLGSDYE 133 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.131 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,348 Number of Sequences: 1233 Number of extensions: 1063 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 68 length of database: 328,796 effective HSP length: 39 effective length of query: 29 effective length of database: 280,709 effective search space: 8140561 effective search space used: 8140561 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)