RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781222|ref|YP_003065635.1| hypothetical protein
CLIBASIA_05645 [Candidatus Liberibacter asiaticus str. psy62]
         (70 letters)



>gnl|CDD|147913 pfam06012, DUF908, Domain of Unknown Function (DUF908). 
          Length = 313

 Score = 25.0 bits (55), Expect = 3.9
 Identities = 9/28 (32%), Positives = 14/28 (50%), Gaps = 2/28 (7%)

Query: 31  TKKYKITKEEHRVFSECHRIRALRGFND 58
            + Y I +E        HR+R  +GF+D
Sbjct: 187 VEDYSIPEELKFDLL--HRLRLAKGFSD 212


>gnl|CDD|163288 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72
           family.  Members of this protein family occur in
           Mycoplasma mycoides, Mycoplasma hyopneumoniae, and
           related Mycoplasmas in small paralogous families that
           may also include truncated forms and/or pseudogenes.
           Members are predicted lipoproteins with a conserved
           signal peptidase II processing and lipid attachment
           site. Note that the name for certain characterized
           members, p72, reflects an anomalous apparent molecular
           weight, given a theoretical MW of about 61 kDa.
          Length = 541

 Score = 24.8 bits (54), Expect = 5.1
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 2   IKAKEPLEQTIKGLF 16
           IKAKE L++ +KGLF
Sbjct: 240 IKAKEKLDEKLKGLF 254


>gnl|CDD|152238 pfam11802, CENP-K, Centromere-associated protein K.  CENP-K is one
           of seven new CENP-A-nucleosome distal (CAD) centromere
           components (the others being CENP-L, CENP-O, CENP-P,
           CENP-Q, CENP-R and CENP-S) that are identified as
           assembling on the CENP-A nucleosome associated complex,
           NAC. The CENP-A NAC is essential, as disruption of the
           complex causes errors of chromosome alignment and
           segregation that preclude cell survival despite
           continued centromere-derived mitotic checkpoint
           signalling. CENP-K is centromere-associated through its
           interaction with one or more components of the CENP-A
           NAC.
          Length = 273

 Score = 24.5 bits (53), Expect = 6.2
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 3   KAKEPLEQTIKGLF-QQSSTDRYGRIEPMTKKYKITKEEHRVFSEC-HRIRALRGFNDVK 60
           K KE LE+  + L  QQ   D     +   K   +T  E R+F E   ++  ++ + +  
Sbjct: 119 KLKEDLEREQQWLDEQQQILDSLNERQSELKNQVVTFSESRIFQELKTKMLRIKEYKEKL 178

Query: 61  KGALGGF 67
             ALG F
Sbjct: 179 LSALGEF 185


>gnl|CDD|161786 TIGR00240, ATCase_reg, aspartate carbamoyltransferase, regulatory
           subunit.  The presence of this regulatory subunit allows
           feedback inhibition by CTP on aspartate
           carbamoyltransferase, the first step in the synthesis of
           CTP from aspartate. In many species, this regulatory
           subunit is not present. In Thermotoga maritima, the
           catalytic and regulatory subunits are encoded by a fused
           gene and the regulatory region has enough sequence
           differences to score below the trusted cutoff.
          Length = 150

 Score = 24.4 bits (53), Expect = 7.4
 Identities = 11/46 (23%), Positives = 24/46 (52%)

Query: 3   KAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECH 48
           K+K  L + I+G+ +  + +     EP++ K+ +  EE  +   C+
Sbjct: 91  KSKPSLPEEIEGVLKCPNPNCISNAEPVSSKFYVRSEEPDIALRCY 136


>gnl|CDD|185492 PTZ00166, PTZ00166, DNA polymerase delta catalytic subunit;
          Provisional.
          Length = 1054

 Score = 24.2 bits (53), Expect = 8.0
 Identities = 10/33 (30%), Positives = 14/33 (42%), Gaps = 1/33 (3%)

Query: 16 FQQSSTDRYGRIEPMTKKYKITKEEHRVFSECH 48
              S  R+    P+ + Y +TKE H V    H
Sbjct: 63 HNTVSGVRHVE-VPIIRLYGVTKEGHSVLVNVH 94


>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional.
          Length = 469

 Score = 24.2 bits (53), Expect = 8.2
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 5/28 (17%)

Query: 22  DRYGRIEPMTKKYKITKEEHRVFSECHR 49
           D YG + P   +Y      HR+F+ECH+
Sbjct: 83  DGYGEVNPKGVEYY-----HRLFAECHK 105


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.322    0.138    0.401 

Gapped
Lambda     K      H
   0.267   0.0627    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,127,621
Number of extensions: 53714
Number of successful extensions: 103
Number of sequences better than 10.0: 1
Number of HSP's gapped: 103
Number of HSP's successfully gapped: 14
Length of query: 70
Length of database: 5,994,473
Length adjustment: 41
Effective length of query: 29
Effective length of database: 5,108,545
Effective search space: 148147805
Effective search space used: 148147805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.3 bits)