HHsearch alignment for GI: 254781223 and conserved domain: cd03360

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Probab=99.66  E-value=1.4e-16  Score=85.66  Aligned_cols=106  Identities=20%  Similarity=0.306  Sum_probs=97.4

Q ss_pred             CCCCEEECCCEEECCCCEECCCCEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             96876988970992883997981545754323112222222100113552022111122211011222221101111111
Q gi|254781223|r    1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVI   80 (110)
Q Consensus         1 i~~n~~I~~~a~I~~~~~I~~n~~I~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~~~~~~~~~~i~~~~~i~   80 (110)
T Consensus        87 Ihp~a~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~i~Hd~~ig~~~~i~~~~~i~g~v~Ig~~~~iG~~~~i~  166 (197)
T cd03360          87 IHPSAVVSPSAVIGEGCVIMAGAVINPDARIGDNVIINTGAVIGHDCVIGDFVHIAPGVVLSGGVTIGEGAFIGAGATII  166 (197)
T ss_pred             ECCCCEECCCCEECCCCEEECCCEECCCCCCCCEEEECCCHHCCCCCCCCCCCEECCCEEECCCEEEEEECCCCCCCEEC
T ss_conf             99995987774799942993175986565304368987700105315013101066723677830891216298998987


Q ss_pred             CCCCCCCCEEECCCEEECCCCEECCCEE
Q ss_conf             1243220139749849988889969809
Q gi|254781223|r   81 GFTVISGNARVRGNAVVGGDTVVEGDTV  108 (110)
Q Consensus        81 ~~~~I~~~~~I~~~~~I~~~~~I~~~~~  108 (110)
T Consensus       167 ~~i~Ig~~~~igags~v~~~--i~~~~~  192 (197)
T cd03360         167 QGVTIGAGAIIGAGAVVTKD--VPDGSV  192 (197)
T ss_pred             CCCEECCCCEECCCCEEEEE--CCCCEE
T ss_conf             99899999999979989125--699909