HHsearch alignment for GI: 254781223 and conserved domain: cd05787

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B epsilon subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold, a central LbH domain containing 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal domain of unknown function that is present in eIF-4 gamma, eIF-5, and eIF-2B epsilon. The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=99.18  E-value=3.1e-11  Score=63.34  Aligned_cols=30  Identities=7%  Similarity=0.203  Sum_probs=15.9

Q ss_pred             CCCCEEECCCEEECCCCEECCCCEECCCCCC
Q ss_conf             9687698897099288399798154575432
Q gi|254781223|r    1 MYDNAVVRDCATVIDDARVSGNASVSRFAQV   31 (110)
Q Consensus         1 i~~n~~I~~~a~I~~~~~I~~n~~I~~~~~i   31 (110)
T Consensus         2 IG~~t~Ig~~~~I~-~svIG~nc~Ig~~~~I   31 (79)
T cd05787           2 IGRGTSIGEGTTIK-NSVIGRNCKIGKNVVI   31 (79)
T ss_pred             CCCCCEECCCCEEE-CCEECCCCEECCCCEE
T ss_conf             99989999999995-9998999999999889