RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781223|ref|YP_003065636.1| intrrupted gp229, phage associated protein [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional. Length = 380 Score = 35.2 bits (82), Expect = 0.004 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 12/101 (11%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRD-----NAKVGGYAKVSG 57 +NA V++ + V++ V G S Q +V + + V+D AK+G + Sbjct: 287 ENAKVKN-SLVVEGCVVYGTVEHSVLFQ---GVQVGEGSVVKDSVIMPGAKIGENVVIE- 341 Query: 58 NASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVG 98 A +G NA++ D +GG VI TVI N + V+G Sbjct: 342 RAIIGENAVIGDGVIIGGGKEVI--TVIGENEVIGVGTVIG 380 >gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase. This model describes LpxD, an enzyme for the biosynthesis of lipid A, a component oflipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria. Some differences are found between lipid A of different species. This protein represents the third step from UDP-N-acetyl-D-glucosamine. The group added at this step generally is 14:0(3-OH) (myristate) but may vary; in Aquifex it appears to be 16:0(3-OH) (palmitate). Length = 324 Score = 34.2 bits (79), Expect = 0.007 Identities = 13/84 (15%), Positives = 32/84 (38%) Query: 17 ARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGD 76 A + A V A++ + N + ++G + +G + ++ D + + + Sbjct: 92 AGIHPTAVVDPSAKIGDGVTIGPNVVIGAGVEIGENVIIGPGVVIGDDVVIGDGSRIHPN 151 Query: 77 AFVIGFTVISGNARVRGNAVVGGD 100 + + N + AV+G D Sbjct: 152 VVIYERVQLGKNVIIHSGAVIGSD 175 Score = 26.9 bits (60), Expect = 1.3 Identities = 15/80 (18%), Positives = 32/80 (40%), Gaps = 12/80 (15%) Query: 11 ATVIDDARVSGNASVSRFAQVKSNAEVSDNT------YVRDNAKVGGYAKVSGNASV--- 61 A V A++ ++ + + E+ +N + D+ +G +++ N + Sbjct: 98 AVVDPSAKIGDGVTIGPNVVIGAGVEIGENVIIGPGVVIGDDVVIGDGSRIHPNVVIYER 157 Query: 62 ---GGNAIVRDTAEVGGDAF 78 G N I+ A +G D F Sbjct: 158 VQLGKNVIIHSGAVIGSDGF 177 Score = 25.3 bits (56), Expect = 3.6 Identities = 18/76 (23%), Positives = 28/76 (36%), Gaps = 2/76 (2%) Query: 24 SVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIG-F 82 R A + A V + + D +G + +G N I+ V GD VIG Sbjct: 87 PPKREAGIHPTAVVDPSAKIGDGVTIGPNVVIGAGVEIGENVII-GPGVVIGDDVVIGDG 145 Query: 83 TVISGNARVRGNAVVG 98 + I N + +G Sbjct: 146 SRIHPNVVIYERVQLG 161 >gnl|CDD|130911 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. This model describes LpxA, an enzyme for the biosynthesis of lipid A, a component oflipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria. Some differences are found between lipid A of different species, but this protein represents the first step (from UDP-N-acetyl-D-glucosamine) and appears to be conserved in function. Proteins from this family contain many copies of the bacterial transferase hexapeptide repeat (pfam00132). Length = 254 Score = 32.2 bits (74), Expect = 0.029 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 9/109 (8%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVG 62 DN +R+ T+ G AS ++ +N + +++ + VG + ++ NA++ Sbjct: 81 DNNTIREFVTI-----NRGTASGGGVTRIGNNNLLMAYSHIAHDCVVGNHVILANNATLA 135 Query: 63 GNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGD----TVVEGDT 107 G+ V D A +GG V F I A + G + V D +VEG+ Sbjct: 136 GHVEVGDYAIIGGLVAVHQFVRIGRYAMIGGLSAVSKDVPPYGLVEGNR 184 Score = 29.5 bits (67), Expect = 0.20 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Query: 45 DNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGD 100 +N ++G + V +G D E+ ++G T I R+ AV+GG Sbjct: 15 ENVEIGPFCIVGPGVKIG------DGVELKSHVVILGHTTIGEGTRIFPGAVIGGV 64 Score = 27.2 bits (61), Expect = 1.1 Identities = 9/43 (20%), Positives = 19/43 (44%) Query: 65 AIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDT 107 AI+ AE+G + + F ++ ++ + V+ G T Sbjct: 5 AIIEPGAEIGENVEIGPFCIVGPGVKIGDGVELKSHVVILGHT 47 Score = 26.5 bits (59), Expect = 1.8 Identities = 16/103 (15%), Positives = 35/103 (33%), Gaps = 13/103 (12%) Query: 11 ATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIV--- 67 A + A + N + F V ++ D ++ + + G+ + + A++ Sbjct: 5 AIIEPGAEIGENVEIGPFCIVGPGVKIGDGVELKSHVVILGHTTIGEGTRIFPGAVIGGV 64 Query: 68 -RDTAEVGGDAFVI---------GFTVISGNARVRGNAVVGGD 100 +D G +I T+ G A G +G + Sbjct: 65 PQDLKYKGERTELIIGDNNTIREFVTINRGTASGGGVTRIGNN 107 >gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase. Alternate name: tetrahydrodipicolinate N-acetyltransferase. Note that IUBMB lists this alternate name as the accepted name. Unfortunately, the related succinyl transferase acting on the same substrate (EC:2.3.1.117, TIGR00695) uses the opposite standard. We have decided to give these two enzymes names which more clearly indicated that they act on the same substrate. Length = 231 Score = 32.0 bits (73), Expect = 0.030 Identities = 33/111 (29%), Positives = 47/111 (42%), Gaps = 8/111 (7%) Query: 4 NAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGG 63 NA + A + D + NA + A + AE+ + T + NA +GG A V N +G Sbjct: 86 NARIEPGAIIRDQVIIGDNAVIMMGAVINIGAEIGEGTMIDMNAVLGGRATVGKNVHIGA 145 Query: 64 NAIVRDTAE-------VGGDAFVIGF-TVISGNARVRGNAVVGGDTVVEGD 106 A++ E V D +IG VI RV AVV +V D Sbjct: 146 GAVLAGVIEPPSAKPVVIEDNVLIGANAVILEGVRVGKGAVVAAGAIVTED 196 Score = 24.7 bits (54), Expect = 5.5 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 6/74 (8%) Query: 32 KSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARV 91 NA + +RD +G NA + A++ AE+G + V+ G A V Sbjct: 84 NINARIEPGAIIRDQVIIG------DNAVIMMGAVINIGAEIGEGTMIDMNAVLGGRATV 137 Query: 92 RGNAVVGGDTVVEG 105 N +G V+ G Sbjct: 138 GKNVHIGAGAVLAG 151 >gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 456 Score = 30.4 bits (69), Expect = 0.096 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 10/63 (15%) Query: 12 TVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRD-----NAKVGGYAKVS-----GNASV 61 +V++DA + ++ FA+++ AE+++ +V + A++G +K G+A + Sbjct: 313 SVVEDANLGAACTIGPFARLRPGAELAEGAHVGNFVEMKKARLGKGSKAGHLTYLGDAEI 372 Query: 62 GGN 64 G N Sbjct: 373 GDN 375 >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional. Length = 255 Score = 30.0 bits (68), Expect = 0.13 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Query: 53 AKVSGNASVGGNAIVRDTAEVGGD------AFVIGFTVISGNARVRGNAVVGGD 100 AK+ +G A++ E+G A ++G T I N ++ AVVG + Sbjct: 12 AKLGSGVEIGPFAVIGANVEIGDGTWIGPHAVILGPTRIGKNNKIHQGAVVGDE 65 Score = 30.0 bits (68), Expect = 0.13 Identities = 13/53 (24%), Positives = 26/53 (49%) Query: 34 NAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVIS 86 + ++ +N + + A + G+ V A + GN +V +G A + G + IS Sbjct: 119 DCQIGNNVILVNGALLAGHVTVGDRAIISGNCLVHQFCRIGALAMMAGGSRIS 171 Score = 26.9 bits (60), Expect = 1.0 Identities = 12/85 (14%), Positives = 33/85 (38%) Query: 22 NASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIG 81 ++ R + + ++ + + V ++ N + A++ VG A + G Sbjct: 89 GVTIHRGTKGGGVTRIGNDNLLMAYSHVAHDCQIGNNVILVNGALLAGHVTVGDRAIISG 148 Query: 82 FTVISGNARVRGNAVVGGDTVVEGD 106 ++ R+ A++ G + + D Sbjct: 149 NCLVHQFCRIGALAMMAGGSRISKD 173 Score = 26.1 bits (58), Expect = 2.2 Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 17 ARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRD 69 A++ + FA + +N E+ D T++ +A + G ++ N + A+V D Sbjct: 12 AKLGSGVEIGPFAVIGANVEIGDGTWIGPHAVILGPTRIGKNNKIHQGAVVGD 64 >gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff. Length = 201 Score = 29.4 bits (67), Expect = 0.21 Identities = 24/108 (22%), Positives = 43/108 (39%), Gaps = 19/108 (17%) Query: 9 DCATVID-DARVSGNAS------VSRFAQVKSNAEVSDNTYVRDNA------KVGGYAKV 55 AT+I A VS +AS + A + + + DN + A +G Y + Sbjct: 85 RFATLIHPSAIVSPSASIGEGTVIMAGAVINPDVRIGDNVIINTGAIVEHDCVIGDYVHI 144 Query: 56 SGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVV 103 + ++ G ++ + +G G T+I + A+VG VV Sbjct: 145 APGVTLSGGVVIGEGVFIG-----AGATII-QGVTIGAGAIVGAGAVV 186 >gnl|CDD|179994 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional. Length = 262 Score = 28.9 bits (66), Expect = 0.31 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 65 AIVRDTAEVGGDAFVIG-FTVISGNARVRGNAVVGGDTVVEGDTVL 109 AIV A++G + IG F VI N + V+G V++G T + Sbjct: 9 AIVEPGAKIGENV-EIGPFCVIGPNVVIGDGTVIGSHVVIDGHTTI 53 >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 458 Score = 27.9 bits (63), Expect = 0.53 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRD-----NAKVGGYAKVS- 56 D + +VI++++V N +V FA ++ + + + + + + +G KVS Sbjct: 305 DGVTIT--NSVIEESKVGDNVTVGPFAHLRPGSVIGEEVKIGNFVEIKKSTIGEGTKVSH 362 Query: 57 ----GNASVGGN 64 G+A VG N Sbjct: 363 LTYIGDAEVGEN 374 >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 450 Score = 28.0 bits (63), Expect = 0.55 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 8/53 (15%) Query: 12 TVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGN 64 ++I+++++ N +V + VSD+ + D K+G YA + A +G N Sbjct: 293 SLIENSQIGENVTVL-------YSVVSDSQ-IGDGVKIGPYAHLRPEAQIGSN 337 >gnl|CDD|177989 PLN02357, PLN02357, serine acetyltransferase. Length = 360 Score = 27.9 bits (62), Expect = 0.56 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 12/74 (16%) Query: 31 VKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGF-TVISGNA 89 + A V +N + N +GG K SG D GD +IG T I GN Sbjct: 249 IGETAVVGNNVSILHNVTLGGTGKQSG-----------DRHPKIGDGVLIGAGTCILGNI 297 Query: 90 RVRGNAVVGGDTVV 103 + A +G +VV Sbjct: 298 TIGEGAKIGAGSVV 311 >gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional. Length = 343 Score = 27.8 bits (63), Expect = 0.59 Identities = 18/90 (20%), Positives = 33/90 (36%), Gaps = 12/90 (13%) Query: 11 ATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDT 70 A + A++ S+ A + + + D + A +G K+ + + N + Sbjct: 107 AVIDPSAKIGEGVSIGPNAVIGAGVVIGDGVVIGAGAVIGDGVKIGADCRLHANVTIY-- 164 Query: 71 AEVGGDAFVIGFTVISGNARVRGNAVVGGD 100 A IG VI + AV+G D Sbjct: 165 -----HAVRIGNRVI-----IHSGAVIGSD 184 Score = 23.9 bits (53), Expect = 8.3 Identities = 16/86 (18%), Positives = 31/86 (36%), Gaps = 5/86 (5%) Query: 28 FAQVKSNAEVSDNTYVRDNAKVGGY----AKVSGNASVGGNAIVRDTAEVGGDAFVIGFT 83 F + V N Y A++ A S A + +A++ +A++G + Sbjct: 67 FVPAGNALLVVKNPY-LAFARLAQLFDPPATPSPAAGIHPSAVIDPSAKIGEGVSIGPNA 125 Query: 84 VISGNARVRGNAVVGGDTVVEGDTVL 109 VI + V+G V+ + Sbjct: 126 VIGAGVVIGDGVVIGAGAVIGDGVKI 151 >gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase. This protein is a bifunctional enzyme, GlmU, which catalyzes last two reactions in the four-step pathway of UDP-N-acetylglucosamine biosynthesis from fructose-6-phosphate. Its reaction product is required from peptidoglycan biosynthesis, LPS biosynthesis in species with LPS, and certain other processes. Length = 451 Score = 27.2 bits (61), Expect = 0.90 Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Query: 66 IVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE 110 +R T E+G D I N + G +G D V+ V++ Sbjct: 257 DIRGTVEIGRD------VEIDPNVILEGKVKIGDDVVIGPGCVIK 295 Score = 27.2 bits (61), Expect = 0.97 Identities = 14/72 (19%), Positives = 34/72 (47%), Gaps = 11/72 (15%) Query: 3 DNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRD-----NAKVGGYAKVS- 56 N V++ +V++ + + V FA+++ + + ++ + NA++G +K Sbjct: 301 SNVVIKA-YSVLEGSEIGEGCDVGPFARLRPGSVLGAGVHIGNFVETKNARIGKGSKAGH 359 Query: 57 ----GNASVGGN 64 G+A +G N Sbjct: 360 LSYLGDAEIGSN 371 >gnl|CDD|130240 TIGR01172, cysE, serine O-acetyltransferase. Cysteine biosynthesis. Length = 162 Score = 25.7 bits (57), Expect = 2.3 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Query: 35 AEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGN 94 A + D+ + +GG K G + V + +G A V+G + NA++ N Sbjct: 88 AVIGDDVTIYHGVTLGGTGKEKGKR----HPTVGEGVMIGAGAKVLGNIEVGENAKIGAN 143 Query: 95 AVVGGDTVVEGDTV 108 +VV D V G TV Sbjct: 144 SVVLKD-VPPGATV 156 Score = 25.7 bits (57), Expect = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 8/45 (17%) Query: 43 VRDNAKVGGYAKVSGN------ASVGGNAIVRDTAEVGGDAFVIG 81 V + +G AKV GN A +G N++V +V A V+G Sbjct: 116 VGEGVMIGAGAKVLGNIEVGENAKIGANSVV--LKDVPPGATVVG 158 >gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 446 Score = 26.0 bits (58), Expect = 2.4 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 10/62 (16%) Query: 14 IDDARVSGNASVSRFAQVKSNAEVSDNTYVRD-----NAKVGGYAKVS-----GNASVGG 63 ++ A V A V +A+++ AE+ + V + NAK+G AKV+ G+A++G Sbjct: 301 LEGAHVGEGAEVGPYARLRPGAELGEGAKVGNFVEVKNAKLGEGAKVNHLTYIGDATIGA 360 Query: 64 NA 65 A Sbjct: 361 GA 362 >gnl|CDD|162818 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function. This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide. This domain is roughly 700 amino acids in size and is found in polypeptides roughly twice that size. Length = 695 Score = 25.1 bits (55), Expect = 3.7 Identities = 10/50 (20%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Query: 60 SVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL 109 ++G IVR + G + +G + +A +G + ++ DT + Sbjct: 133 TIGAGTIVRKEVMLLG-YRAERGRLHTGPVTLGRDAFIGTRSTLDIDTSI 181 >gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 481 Score = 25.3 bits (55), Expect = 4.0 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 63 GNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE 110 G ++ DT +G D + ++ G RV +G +VV D+VL Sbjct: 263 GTILIEDTVTLGRDVTIEPGVLLRGQTRVADGVTIGAYSVVT-DSVLH 309 >gnl|CDD|162198 TIGR01090, apt, adenine phosphoribosyltransferase. A phylogenetic analysis suggested omitting the bi-directional best hit homologs from the spirochetes from the seed for this model and making only tentative predictions of adenine phosphoribosyltransferase function for this lineage. Length = 169 Score = 24.5 bits (54), Expect = 6.0 Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 57 GNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVV 97 G A I + EV AF+I ++G A++ N V Sbjct: 123 GTAEATDELIRKLGGEVVEAAFLIELKDLNGRAKLEPNVPV 163 >gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional. Length = 183 Score = 24.0 bits (52), Expect = 8.2 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 33 SNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGN-ARV 91 S AE+ + +N +GG A ++ ++G N +V A V D V V+ GN AR+ Sbjct: 122 SGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKD--VPDNVVVGGNPARI 179 >gnl|CDD|162226 TIGR01150, puhA, photosynthetic reaction center, subunit H, bacterial. This model describes the photosynthetic reaction center H subunit in non-oxygenic photosynthetic bacteria. The reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in the form of NADH. Ultimately, the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is an organic acid rather than water. Much of our current functional understanding of photosynthesis comes from the structural determination and spectroscopic studies on the reaction center of Rhodobacter sphaeroides. Length = 252 Score = 24.0 bits (52), Expect = 8.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 81 GFTVISGNARVRGNAVVGGDTVVEGDTV 108 F+V +G+ RG VV D V G Sbjct: 141 DFSVAAGDVDPRGLPVVAADGEVAGKVT 168 >gnl|CDD|171853 PRK13038, PRK13038, superantigen-like protein; Reviewed. Length = 227 Score = 24.2 bits (52), Expect = 8.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 49 VGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGF 82 VGG + + + V I+ + E G DAFV G+ Sbjct: 116 VGGVIQNNKTSGVVSAPILNISKEKGEDAFVKGY 149 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.131 0.358 Gapped Lambda K H 0.267 0.0844 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,658,116 Number of extensions: 91557 Number of successful extensions: 227 Number of sequences better than 10.0: 1 Number of HSP's gapped: 201 Number of HSP's successfully gapped: 68 Length of query: 110 Length of database: 5,994,473 Length adjustment: 76 Effective length of query: 34 Effective length of database: 4,352,265 Effective search space: 147977010 Effective search space used: 147977010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (22.8 bits)