RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 38.8 bits (89), Expect = 3e-04 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 11/37 (29%) Query: 2 EKTAVRQKVQKDSVEIRFTKL---ETALPYLATKADL 35 EK A++ K+Q S+ KL ++A P LA KA + Sbjct: 18 EKQALK-KLQA-SL-----KLYADDSA-PALAIKATM 46 Score = 28.4 bits (62), Expect = 0.35 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Query: 43 KQDIANVRTELK--ADIADVRTELACTKSELK 72 KQ + ++ LK AD D LA K+ ++ Sbjct: 19 KQALKKLQASLKLYAD--DSAPALA-IKATME 47 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 34.9 bits (80), Expect = 0.005 Identities = 16/93 (17%), Positives = 25/93 (26%), Gaps = 32/93 (34%) Query: 12 KDSVEIRFTKLETALP--------YLATKADLADVRTELKQDIANVRTELKADIADVRTE 63 K RF LP L + +D+ A D++ Sbjct: 413 KLKFSNRF------LPVASPFHSHLLV------PASDLINKDLVKNNVSFNAK--DIQIP 458 Query: 64 LACTK--SELKDAINSQTKWFMGIIVSVLVSTI 94 + T S+L+ S I +V I Sbjct: 459 VYDTFDGSDLRVLSGS--------ISERIVDCI 483 Score = 30.3 bits (68), Expect = 0.10 Identities = 8/35 (22%), Positives = 16/35 (45%), Gaps = 10/35 (28%) Query: 64 LACTKSELKDAI-----NSQTKWFMGIIVSVLVST 93 L T EL+ + +SQ G++ +V ++ Sbjct: 256 LGFTPGELRSYLKGATGHSQ-----GLVTAVAIAE 285 >1wjw_A Phosphoacetylglucosamine mutase; carbohydrate metabolism, structural genomics, riken structural genomics/proteomics initiative, RSGI, isomerase; NMR {Mus musculus} SCOP: d.129.2.1 Length = 112 Score = 27.6 bits (61), Expect = 0.70 Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 31 TKADLADVRTELKQDIANVRTELKADIADVRTELACTKSE-LKDAINSQTKWF 82 + + +L V+ + I+ E L++AIN K + Sbjct: 2 SSGSSGAIYVDLPNRQLKVKVADRRVISTTDAERQAVTPPGLQEAINDLVKKY 54 >3ffz_A Botulinum neurotoxin type E; botulinum neurotoxin serotype E, botulism, domain organization, endopeptidase, translocation, hydrolase; 2.65A {Clostridium botulinum} Length = 1252 Score = 27.1 bits (60), Expect = 0.96 Identities = 9/40 (22%), Positives = 17/40 (42%) Query: 41 ELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTK 80 +L++ NV+T L I + L ++ EL + Sbjct: 781 KLREYDENVKTYLLNYIIQHGSILGESQQELNSMVTDTLN 820 >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Length = 191 Score = 27.2 bits (60), Expect = 1.0 Identities = 10/44 (22%), Positives = 21/44 (47%) Query: 37 DVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTK 80 + R L +++ + L AD+ DV L + E++ + T+ Sbjct: 88 ETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTE 131 Score = 24.5 bits (53), Expect = 5.7 Identities = 12/49 (24%), Positives = 19/49 (38%) Query: 32 KADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTK 80 AD+ DV L Q V+ L ++R LA +L+ + Sbjct: 105 GADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDAD 153 Score = 24.5 bits (53), Expect = 6.5 Identities = 12/79 (15%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Query: 2 EKTAVRQKVQKDSVEIRFTKLETALPYLATKAD--LADVRTELKQDIANVRTELKADIAD 59 E A + ++ D ++ +L + ++R L + +R L D D Sbjct: 96 ELQAAQARLGADMEDVC-GRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADD 154 Query: 60 VRTELACTKSELKDAINSQ 78 ++ LA ++ ++ Sbjct: 155 LQKRLAVYQAGAREGAERG 173 >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 2hlf_A ... Length = 465 Score = 24.7 bits (53), Expect = 5.1 Identities = 5/23 (21%), Positives = 7/23 (30%) Query: 81 WFMGIIVSVLVSTIGILLKLSSH 103 FM +V LV + Sbjct: 36 LFMAAVVGTLVGLAAVAFDKGVA 58 >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 1t9z_A* 1ta0_A* 2q5e_A Length = 181 Score = 24.6 bits (53), Expect = 5.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 20 TKLETALPYLATKADLADVRTELKQ 44 T+L LP+ + + DV + L+Q Sbjct: 157 TELHDLLPFFEQLSRVDDVYSVLRQ 181 >2nyy_A Botulinum neurotoxin type A; neurotoxin, FAB, protein antibody complex, toxin/immune system complex; 2.61A {Clostridium botulinum} PDB: 2nz9_A 3bta_A Length = 1295 Score = 24.1 bits (52), Expect = 9.1 Identities = 11/40 (27%), Positives = 17/40 (42%) Query: 41 ELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTK 80 L+ A+++ L I D R L LKD +N+ Sbjct: 806 RLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLS 845 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.129 0.338 Gapped Lambda K H 0.267 0.0723 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 701,164 Number of extensions: 25236 Number of successful extensions: 92 Number of sequences better than 10.0: 1 Number of HSP's gapped: 89 Number of HSP's successfully gapped: 25 Length of query: 103 Length of database: 5,693,230 Length adjustment: 68 Effective length of query: 35 Effective length of database: 4,044,638 Effective search space: 141562330 Effective search space used: 141562330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)