RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Length = 144 Score = 30.2 bits (68), Expect = 0.052 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Query: 3 KTAVRQKVQKDSVEIRFTKLETALPYLATK--ADLADVRTELKQDIANVRTELKADIADV 60 K+ + +++ + E R +L L + AD+ DVR L Q V+ L ++ Sbjct: 54 KSELEEQLTPVAEETR-ARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEEL 112 Query: 61 RTELACTKSELKDAINSQT 79 R LA +L+ + Sbjct: 113 RVRLASHLRKLRKRLLRDA 131 >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Score = 24.6 bits (53), Expect = 2.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 20 TKLETALPYLATKADLADVRTELKQ 44 T+L LP+ + + DV + L+Q Sbjct: 157 TELHDLLPFFEQLSRVDDVYSVLRQ 181 >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 Score = 24.4 bits (52), Expect = 2.9 Identities = 5/23 (21%), Positives = 7/23 (30%) Query: 81 WFMGIIVSVLVSTIGILLKLSSH 103 FM +V LV + Sbjct: 20 LFMAAVVGTLVGLAAVAFDKGVA 42 >d1aopa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]} Length = 80 Score = 23.9 bits (52), Expect = 3.7 Identities = 6/42 (14%), Positives = 17/42 (40%) Query: 3 KTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQ 44 KT + + + + R T + + +++ A + K+ Sbjct: 31 KTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKE 72 >d1wjwa_ d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Score = 23.8 bits (51), Expect = 3.8 Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 31 TKADLADVRTELKQDIANVRTELKADIADVRTELACTKSE-LKDAINSQTKWF 82 + + +L V+ + I+ E L++AIN K + Sbjct: 2 SSGSSGAIYVDLPNRQLKVKVADRRVISTTDAERQAVTPPGLQEAINDLVKKY 54 >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Length = 147 Score = 23.9 bits (51), Expect = 4.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 68 KSELKDAINSQTKWFMGIIVSVLVSTIGILL 98 ++ I+ TK F+G L T+ I+L Sbjct: 115 LKQILHGIHHGTKTFVGGAAEPLRRTLRIIL 145 >d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Score = 23.5 bits (51), Expect = 4.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 8 QKVQKDSVEIRF 19 KVQKD +E+RF Sbjct: 25 DKVQKDDIEVRF 36 >d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Score = 23.1 bits (50), Expect = 5.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Query: 8 QKVQKDSVEIRF 19 KVQK+ +E+ F Sbjct: 27 DKVQKEDIEVYF 38 >d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 63 Score = 23.1 bits (50), Expect = 6.5 Identities = 6/23 (26%), Positives = 13/23 (56%) Query: 70 ELKDAINSQTKWFMGIIVSVLVS 92 E N++T G+I+ V+++ Sbjct: 30 EFCKRFNAETADKAGMILPVVIT 52 >d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Length = 584 Score = 22.8 bits (48), Expect = 8.3 Identities = 9/85 (10%), Positives = 31/85 (36%), Gaps = 8/85 (9%) Query: 6 VRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELA 65 + + V +R ++ L + +++ + E+ + ++ +I LA Sbjct: 366 INALKTERDVSVRQRAVDL-LYAMCDRSNAQQIVAEMLSYLETADYSIREEIVLKVAILA 424 Query: 66 CTKSELKDAINSQTKWFMGIIVSVL 90 + W++ I++++ Sbjct: 425 -------EKYAVDYTWYVDTILNLI 442 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.129 0.338 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 305,341 Number of extensions: 10987 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's gapped: 38 Number of HSP's successfully gapped: 15 Length of query: 103 Length of database: 2,407,596 Length adjustment: 64 Effective length of query: 39 Effective length of database: 1,528,876 Effective search space: 59626164 Effective search space used: 59626164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.4 bits)