HHsearch alignment for GI: 254781225 and conserved domain: COG5545

>COG5545 Predicted P-loop ATPase and inactivated derivatives [General function prediction only].
Probab=98.13  E-value=3.8e-05  Score=51.93  Aligned_cols=182  Identities=18%  Similarity=0.256  Sum_probs=129.1

Q ss_pred             CHHHHHHHHHHHCC--CHHHH-----HHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             94789999988879--99999-----999999999975987433799997078862578999999972330003442676
Q gi|254781225|r  465 PSQEFLDLVSGYFE--SEEVM-----DYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASD  537 (789)
Q Consensus       465 ~~p~~~~~l~~~~~--d~e~~-----~~l~~~~g~~l~g~~~~~~~~~~~G~G~nGKSt~~~~l~~llG~~~~~~~~~~~  537 (789)
T Consensus       159 ~v~r~~~l~~dyfGa~ds~l~~~~~k~f~VgAVarv~~Pg~K~Df~l~L~G~Qgs~KsTfl~---~l~G~~wftd~~~~~  235 (517)
T COG5545         159 GVPRVETLLIDYFGASDSTLARQASKCFMVGAVARVLWPGAKVDFMLVLEGPQGSHKSTFLS---ELFGTYWFTDTAESP  235 (517)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCHHH---HHCCCEEEECCCCCC
T ss_conf             96279898898727887389999998899999998737887520689974477777322699---861860340345588


Q ss_pred             HHHCCCCCCCCCCHHHHHHCCCEEEEEECCCCCCCCCCCEEEEEECCCEEEEEECCCCCCEEEECCEEEEEECCCCCCCC
Q ss_conf             42012455556898899738980999934677760131002454159858732104786068714528999738863426
Q gi|254781225|r  538 IMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVR  617 (789)
Q Consensus       538 ~~~~~~~~~~~~~~~la~l~g~r~~~~~E~~~~~~~~~~~~K~ltggD~i~ar~~~~~~~~~~~p~~~~~~~~N~~P~~~  617 (789)
T Consensus       236 -t---------~KD~~~~i~~~wive~~Em~s~~K~dvt~lK~fitr~~dsfRaPYgt~~e~y~r~~V~vgTTN~~Eylk  305 (517)
T COG5545         236 -T---------GKDFYQVIQGCWIVEIGEMDSFGKADVTALKVFITRRTDSFRAPYGTLPESYRRECVFVGTTNDREYLK  305 (517)
T ss_pred             -C---------CCHHHHHHHHHHEEEHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCHHHCCCCEEEEECCCHHHHHC
T ss_conf             -8---------505999976553341055554268878999999987036301765688555466517972156687610


Q ss_pred             CCCCCEEEEEEEEECCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7984166468999658878887878334220120447999999999999987889
Q gi|254781225|r  618 NPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLD  672 (789)
Q Consensus       618 ~~d~~~~rR~~iipF~~~~~~~d~~~~~~~~~~e~~~i~~w~l~g~~~~~~~g~~  672 (789)
T Consensus       306 D~TG~--RRFlpV~~~k~v~~~------~~-v~erD--q~Wae--aV~~y~~gf~  347 (517)
T COG5545         306 DATGG--RRFLPVRADKNVDVS------RI-VAERD--QLWAE--AVQLYLDGFP  347 (517)
T ss_pred             CCCCC--EEEEEEEECCCCCHH------HH-HHHHH--HHHHH--HHHHHHCCCC
T ss_conf             67787--367888765767655------54-46789--99999--9999864785