HHsearch results for GI: 254781225 and protein with PDBid: 1zp6_A

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25
Probab=91.01  E-value=0.12  Score=27.10  Aligned_cols=30  Identities=30%  Similarity=0.372  Sum_probs=25.5

Q ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             379999707886257899999997233000
Q gi|254781225|r  501 QRFIHIRGVGGSGKSTLMNLIKYAFGNQYV  530 (789)
Q Consensus       501 ~~~~~~~G~G~nGKSt~~~~l~~llG~~~~  530 (789)
                      ..++++.|+.|+||||+.+.|...+|-..+
T Consensus         9 G~iI~i~G~~GsGKTT~a~~La~~lg~~~~   38 (191)
T 1zp6_A            9 GNILLLSGHPGSGKSTIAEALANLPGVPKV   38 (191)
T ss_dssp             TEEEEEEECTTSCHHHHHHHHHTCSSSCEE
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             818999899999889999999999699989