RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] (789 letters) >gnl|CDD|33185 COG3378, COG3378, Predicted ATPase [General function prediction only]. Length = 517 Score = 128 bits (322), Expect = 7e-30 Identities = 111/472 (23%), Positives = 179/472 (37%), Gaps = 44/472 (9%) Query: 302 LLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVS 361 + A R +D Y + ++ +G + D + W K D L + +I Sbjct: 42 INAVRLADRYTDKLRAVSAQGTWHV-WDGRRWAKDDA-------LLFLPLDVAIRGLKRQ 93 Query: 362 MKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDL 421 D +K Y E + A + T Sbjct: 94 AAIKADHDRGLKADPDKLEAPLSTAGVRSYFPNPTEV--------KEALALVKKAATPKQ 145 Query: 422 LDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEP-------SQEFLDLVS 474 D + +G+LDL TGQ E T+ + + +E+LD V+ Sbjct: 146 QDPDPHLINFANGVLDLRTGQLEPHDPEDRFTRIIPVDYTDPAADPSHCPKWREWLDRVA 205 Query: 475 GYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAE 534 G E+ + R +G +L G Q+ + G GG+GKST ++LI G V +A Sbjct: 206 G--GDPELRNLLQRIIGASLTGRVSEQKLFWLYGPGGNGKSTFVDLISNLLGRYNVTSAP 263 Query: 535 ASDIMQNRPPEAGKANPS-LIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNY 593 +D+ EA +P L L+G R+V +SET + + K+K +TGGD ++A Sbjct: 264 LTDL------EADDRHPFGLAALVGKRLVTVSETEKGRLDDEGKLKALTGGDVISAERKR 317 Query: 594 GNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTL 653 + +S +P + N +R D+A WRR +++PF+K + KL+ K Sbjct: 318 KDFFSFTP-NAKLIQATNHPPRIRGDDEAIWRRLLIVPFEKQFPPAERDD--KLDEKLAA 374 Query: 654 EAK---KWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEE 710 E W + G +GL D P+ L A EE ++ D + DD C +GE Sbjct: 375 ERPGILNWLVAGFLDLQREGL--DQPQAVLDALEEYKRENDPVFQFCDDECVLGETDGTP 432 Query: 711 SHSLAKS---YSEYREQELNYDRKRISTRTVTLNLK-QKGFIGGIKREKIEK 758 + Y Y+E ++T KG G KR + E Sbjct: 433 TAFDNIVLELYEAYQEWCEANGYVVELSKTRFGKELPTKGVPKGRKRHQGET 484 >gnl|CDD|80309 cd04859, Prim_Pol, Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol). These primpol domains belong to the archaeal/eukaryal primase (AEP) superfamily. This group includes archaeal plasmids and bacteriophage AEPs. The ORF904 protein is a multifunctional protein having ATPase, primase and DNA polymerase activity, and may play a role in the replication of the archaeal plasmid. The pRN1 primpol domain exhibits DNA polymerase and primase activities; a cluster of active site residues (three acidic residues, and a histidine) is required for both these activities. For pRN1 primpol, the primase activity prefers dNTPs to rNTPs; incorporation of dNTPs requires rNTP as cofactor. The pRN1 primpol contains an unusual zinc-binding stem, which is not conserved in other members of this group.. Length = 152 Score = 58.9 bits (142), Expect = 5e-09 Identities = 36/144 (25%), Positives = 51/144 (35%), Gaps = 11/144 (7%) Query: 18 FKLIPLRLGDKRP-QRLGKWEEQLLSSEKIDKL----PACGFGFVCGVGEQPLYAFDIDS 72 F +IPL G KRP + + E+I+ P G G L DID Sbjct: 1 FAVIPLDPGSKRPLIKGWPKDAATTDPEQIEAWWRDGPDANIGLRTGPSG--LVVIDIDV 58 Query: 73 KDEKTANTFK--DTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILG 130 K + A + ++ T VR G + FR+ +G+ K +DI G Sbjct: 59 KHDGAAALAALAELGKLPPLTLTVRTG-SGGRHLYFRVP-DGVPVKSVKGKGGPGIDIRG 116 Query: 131 CGQYFVAYNIHPKTKKEYTWTTPP 154 G Y VA Y W + Sbjct: 117 GGGYVVAPPSVHPGGGYYVWKSTV 140 >gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.. Length = 186 Score = 34.1 bits (78), Expect = 0.14 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Query: 471 DLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLI 521 DL++ S Y V +A++ I I G GSGK+TL+N + Sbjct: 3 DLIAQGTFSPLQAAYLWLAV--------EARKNILISGGTGSGKTTLLNAL 45 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 33.6 bits (77), Expect = 0.24 Identities = 12/19 (63%), Positives = 15/19 (78%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ I G GSGKSTL+NL+ Sbjct: 33 FVAIVGPSGSGKSTLLNLL 51 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 33.2 bits (76), Expect = 0.28 Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ I G GSGKSTL+N++ Sbjct: 32 FVAIVGPSGSGKSTLLNIL 50 >gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair]. Length = 935 Score = 32.8 bits (75), Expect = 0.40 Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 501 QRFIHIRGVGGSGKSTLMNLIKYA 524 F + GV GSGKSTL+N Sbjct: 627 GVFTCVTGVSGSGKSTLINDTLVP 650 >gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908 Score = 31.9 bits (72), Expect = 0.65 Identities = 44/282 (15%), Positives = 93/282 (32%), Gaps = 40/282 (14%) Query: 506 IRGVGGSGKSTLMNLIKYA-FGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVII 564 I G G+GKS++++ I +A +G + A + D + ++ + G + I Sbjct: 30 IVGPNGAGKSSILDAITFALYGKTPRLGAFSLDDLIRAGEKSASVE-LEFEVNGKKYRIE 88 Query: 565 SETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWW 624 E + ++ + G ++ I L D + Sbjct: 89 REFRRGRGQSTGSLQIIEVD---------GERIADGKKDVNEKIEELLGL-----DKDTF 134 Query: 625 RRYIVIP---FDKPI----ANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDV---- 673 R + +P FD + R + + E LK V ++ Sbjct: 135 TRSVYLPQGEFDAFLKSKPKERKEILDELFGLEK-YEKLSELLKEVIKEAKAKIEELEGQ 193 Query: 674 -----DIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNY 728 + E L+A EEE + + ++ E L +E +L + +E E++ Sbjct: 194 LSELLEDIEDLLEALEEELKELKKLEEIQEE--QEEEELEQEIEALEERLAELEEEKERL 251 Query: 729 DRKRISTRTVTLNLKQKGF-----IGGIKREKIEKEWKSKRI 765 + + + + + ++R E E K +R+ Sbjct: 252 EELKARLLEIESLELEALKIREEELRELERLLEELEEKIERL 293 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 31.3 bits (71), Expect = 1.1 Identities = 14/58 (24%), Positives = 23/58 (39%), Gaps = 8/58 (13%) Query: 504 IHIRGVGGSGKSTLMNLIKYAFGNQ----YVINAEASDIMQNRPPEAGKANPSLIRLM 557 I I G GG GK+T+ L+ + I+A+ D+ P + L+ Sbjct: 2 IAITGKGGVGKTTIAALLARYLAEKGKPVLAIDADPDDL----PERLSVEVGEIKLLL 55 >gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 261 Score = 31.3 bits (71), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 502 RFIHIRGVGGSGKSTLMNLIKYA 524 + GV GSGKS+L+N Y Sbjct: 22 VLTCVTGVSGSGKSSLINDTLYP 44 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 31.2 bits (71), Expect = 1.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 +A + I G G+GKSTL+ + Sbjct: 23 EAGEIVGILGPNGAGKSTLLKTL 45 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 30.7 bits (68), Expect = 1.7 Identities = 15/52 (28%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 508 GVGGSGKSTLMN-LIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMG 558 G GG GK+TL+N L+ F Y D + P L G Sbjct: 12 GDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAG 63 >gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]. Length = 231 Score = 30.7 bits (69), Expect = 1.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 500 AQRFIHIRGVGGSGKSTLMNLI 521 A + I G G+GKSTL+NLI Sbjct: 24 AGEIVAILGPSGAGKSTLLNLI 45 >gnl|CDD|30190 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).. Length = 200 Score = 30.6 bits (69), Expect = 1.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 502 RFIHIRGVGGSGKSTLMNLIK 522 FI G+ G+GK+TL+ L+ Sbjct: 1 MFIVFEGIDGAGKTTLIELLA 21 >gnl|CDD|110446 pfam01443, Viral_helicase1, Viral (Superfamily 1) RNA helicase. Helicase activity for this family has been demonstrated and NTPase activity. This helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis. Length = 226 Score = 30.0 bits (68), Expect = 2.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 504 IHIRGVGGSGKSTL 517 I + GV G GKSTL Sbjct: 1 IVVHGVPGCGKSTL 14 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 30.3 bits (68), Expect = 2.3 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 21/57 (36%) Query: 465 PSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLI 521 ++ L VSG + E++ A++G + GSGK+TL+N + Sbjct: 41 KTKTILKGVSGTAKPGELL---------AIMGPS------------GSGKTTLLNAL 76 >gnl|CDD|30474 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism]. Length = 208 Score = 30.2 bits (68), Expect = 2.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 502 RFIHIRGVGGSGKSTLMNLIK 522 FI I G+ G+GK+T L+K Sbjct: 4 MFIVIEGIDGAGKTTQAELLK 24 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 29.9 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 KA + + G GSGKSTL+ I Sbjct: 23 KAGEIVALVGPNGSGKSTLLRAI 45 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 29.8 bits (67), Expect = 3.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 + I G GSGKSTL+ L+ Sbjct: 497 PPGEKVAIVGRSGSGKSTLLKLL 519 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 29.6 bits (67), Expect = 3.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 K + I G GSGKSTL+ L+ Sbjct: 26 KPGEKVAIVGPSGSGKSTLLKLL 48 >gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.. Length = 194 Score = 29.4 bits (66), Expect = 3.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 502 RFIHIRGVGGSGKSTLMNLI 521 I G G+GKSTL+N + Sbjct: 36 ELTAIMGPSGAGKSTLLNAL 55 >gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248 Score = 29.4 bits (66), Expect = 3.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ I G G GKSTL+ LI Sbjct: 31 FVAILGPSGCGKSTLLRLI 49 >gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 29.4 bits (66), Expect = 3.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 KA + + G G+GKSTL+NL+ Sbjct: 345 KAGQLTALVGASGAGKSTLLNLL 367 >gnl|CDD|30197 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.. Length = 187 Score = 29.5 bits (66), Expect = 4.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 504 IHIRGVGGSGKSTLMNLIKYAFGNQYVIN 532 + I GV SGK+TL L++ N VI+ Sbjct: 2 VGISGVTNSGKTTLAKLLQRILPNCCVIH 30 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 29.3 bits (66), Expect = 4.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ + G G GKSTL+ +I Sbjct: 32 FVALVGPSGCGKSTLLRII 50 >gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.. Length = 162 Score = 29.2 bits (65), Expect = 4.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Query: 500 AQRFIHIRGVGGSGKSTLMNLIKYAFGNQYV 530 I G GSGKST+++ I A G Sbjct: 20 EGSLTIITGPNGSGKSTILDAIGLALGGAQS 50 >gnl|CDD|30727 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]. Length = 202 Score = 29.0 bits (65), Expect = 5.0 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 9/87 (10%) Query: 498 NKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLM 557 N+ I + G GSGK+ L+ A ++Y I DI + L +L Sbjct: 10 NRPMLRIGVGGPPGSGKTALIEKTLRALKDEYKIAVITGDIYTKEDADR------LRKLP 63 Query: 558 GSRIVII---SETNENDEINAAKIKQM 581 G I+ + + + +N I+++ Sbjct: 64 GEPIIGVETGKGCHLDASMNLEAIEEL 90 >gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in macrophages, hepatocytes, and intestinal mucosa cells. ABCG1 (ABC8), the human homolog of the Drosophila white gene is induced in monocyte-derived macrophages during cholesterol influx mediated by acetylated low-density lipoprotein. It is possible that human ABCG1 forms heterodimers with several heterologous partners.. Length = 226 Score = 29.0 bits (65), Expect = 5.2 Identities = 19/74 (25%), Positives = 28/74 (37%), Gaps = 27/74 (36%) Query: 473 VSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLI------KYAFG 526 VS + ES +VM A+LG + GSGK+TL++ I Sbjct: 26 VSLHVESGQVM---------AILGSS------------GSGKTTLLDAISGRVEGGGTTS 64 Query: 527 NQYVINAEASDIMQ 540 Q + N + Q Sbjct: 65 GQILFNGQPRKPDQ 78 >gnl|CDD|73034 cd03275, ABC_SMC1_euk, Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 247 Score = 29.0 bits (65), Expect = 5.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Query: 502 RFIHIRGVGGSGKSTLMNLIKYAFG 526 RF I G GSGKS LM+ I + G Sbjct: 23 RFTCIIGPNGSGKSNLMDAISFVLG 47 >gnl|CDD|33194 COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism]. Length = 612 Score = 28.8 bits (64), Expect = 5.4 Identities = 17/82 (20%), Positives = 28/82 (34%), Gaps = 14/82 (17%) Query: 320 KKGHFLYTADTK----------AWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDL 369 + GHF YT T A DK + W T D++ +++ + F Sbjct: 411 RGGHFTYTKATVYAGLDAAADLAEEFGDKGSAEHWRKTADELKEAVLRRGYAEDGGYFVR 470 Query: 370 SEEPEDNNKNSKS----PRFWF 387 S + ++ S F F Sbjct: 471 SLGRKPDDTVDASLLGLVLFGF 492 >gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]. Length = 223 Score = 29.0 bits (65), Expect = 5.5 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 10/42 (23%) Query: 490 VGMALLGGNKAQR----------FIHIRGVGGSGKSTLMNLI 521 V A GG +A R F+ + G G+GKSTL+ LI Sbjct: 7 VSKAYPGGREALRDVSFHIPKGEFVFLTGPSGAGKSTLLKLI 48 >gnl|CDD|30586 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolism]. Length = 201 Score = 28.7 bits (64), Expect = 6.2 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 9/82 (10%) Query: 504 IHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVI 563 I + G GSGKST+ ++ VI+ A D+ + G+A + G I Sbjct: 5 IGLTGGIGSGKSTVAKILAE--LGFPVID--ADDVAREVVEPGGEALQEIAERFGLEI-- 58 Query: 564 ISETNENDEINAAKIKQMTGGD 585 +E+ ++ K+++ D Sbjct: 59 ---LDEDGGLDRRKLREKVFND 77 >gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229 Score = 28.6 bits (64), Expect = 6.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 499 KAQRFIHIRGVGGSGKSTLMNLI 521 K + I G G+GK+TL+NL+ Sbjct: 27 KPGETVAIVGPTGAGKTTLINLL 49 >gnl|CDD|34687 COG5083, SMP2, Uncharacterized protein involved in plasmid maintenance [General function prediction only]. Length = 580 Score = 28.5 bits (63), Expect = 6.7 Identities = 41/207 (19%), Positives = 63/207 (30%), Gaps = 34/207 (16%) Query: 255 KQGSTYDEENFNYKWDTFDFEEIGDTAKKRS--TFTSLFYHHG------------KLIPK 300 GS + NF+ +IG R+ T + +G L K Sbjct: 125 GSGSDLSKLNFDIVLKEPKNLDIGFRKYSRNKRTENTGKRMYGQSSRQRGHKDSYHLFEK 184 Query: 301 GLLASRFSDAYNKA---MFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMN 357 + +F NK M I+K + YK N + S+ D+ T+ Sbjct: 185 RFV--KFGSLLNKTLHFMSLIFKTKTNGDLLTDISLYKPGGNKILDLSVN-DRDTSKDEF 241 Query: 358 FLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFS- 416 F E +PED NS R + N + K+ QS+ ++S Sbjct: 242 FDFKDIE-----FVKPEDTEFNSWINREHVTKLHPHHNGSDEVYGKNPPQSISGDFLYSD 296 Query: 417 --------ITSDLLDSSSRFLGEQDGI 435 S L S S + I Sbjct: 297 VRVSLANDEVSILEYSHSSSEPSWNKI 323 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 28.7 bits (64), Expect = 7.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ + G G GKSTL+ +I Sbjct: 31 FVVLLGPSGCGKSTLLRMI 49 >gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]. Length = 257 Score = 28.7 bits (64), Expect = 7.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 505 HIRGVGGSGKSTLMNLI 521 I G G+GK+TL++L+ Sbjct: 61 AIVGPNGAGKTTLLSLL 77 >gnl|CDD|111487 pfam02594, DUF167, Uncharacterized ACR, YggU family COG1872. Length = 78 Score = 28.3 bits (64), Expect = 7.4 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 7/30 (23%) Query: 543 PPEAGKANPSLIRLMG-------SRIVIIS 565 PP GKAN LI+ + S + I+S Sbjct: 36 PPVDGKANAELIKFLAKTLGVPKSDVEIVS 65 >gnl|CDD|35241 KOG0018, KOG0018, KOG0018, Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]. Length = 1141 Score = 28.3 bits (63), Expect = 8.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Query: 501 QRFIHIRGVGGSGKSTLMNLIKYAFG 526 RF I G GSGKS LM+ I + G Sbjct: 25 DRFTAIIGPNGSGKSNLMDAISFVLG 50 >gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352 Score = 28.3 bits (63), Expect = 8.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 500 AQRFIHIRGVGGSGKSTLMNLI 521 A+ + G GSGK++L+N+I Sbjct: 23 ARGITALFGPSGSGKTSLINMI 44 >gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]. Length = 500 Score = 28.2 bits (63), Expect = 8.4 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 12/30 (40%) Query: 492 MALLGGNKAQRFIHIRGVGGSGKSTLMNLI 521 ALLG N G+GKSTLM ++ Sbjct: 37 HALLGEN------------GAGKSTLMKIL 54 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 28.2 bits (63), Expect = 9.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 503 FIHIRGVGGSGKSTLMNLI 521 F+ I G GSGKSTL+ L+ Sbjct: 29 FVLIVGPNGSGKSTLLRLL 47 >gnl|CDD|147768 pfam05794, Tcp11, T-complex protein 11. This family consists of several eukaryotic T-complex protein 11 (Tcp11) related sequences. Tcp11 is only expressed in fertile adult mammalian testes and is thought to be important in sperm function and fertility. The family also contains the yeast Sok1 protein which is known to suppress cyclic AMP-dependent protein kinase mutants. Length = 423 Score = 28.0 bits (63), Expect = 9.2 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Query: 163 PLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTW 197 PLL E VEY K FQE+ L + S+ +K W Sbjct: 160 PLLIENSVEYERKKFQEL---LEEAPNSLPLTKKW 191 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.134 0.401 Gapped Lambda K H 0.267 0.0745 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 9,783,549 Number of extensions: 528045 Number of successful extensions: 1495 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1490 Number of HSP's successfully gapped: 62 Length of query: 789 Length of database: 6,263,737 Length adjustment: 102 Effective length of query: 687 Effective length of database: 4,059,619 Effective search space: 2788958253 Effective search space used: 2788958253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 61 (27.2 bits)