RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >gnl|CDD|118668 pfam10140, essB, Predicted membrane protein essB. Members of this family of prokaryotic proteins include the virulence factor essB, which is required for the synthesis and secretion of EsxA and EsxB, both ESAT-6 like proteins. Length = 359 Score = 26.5 bits (59), Expect = 1.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 45 ETTDEEKLREYKEFVISAFAKAIS 68 E +E L+EYK F+I+ F S Sbjct: 111 ELDEERFLKEYKAFIIALFDGKYS 134 >gnl|CDD|180976 PRK07431, PRK07431, aspartate kinase; Provisional. Length = 587 Score = 24.9 bits (55), Expect = 5.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 35 RLSVVVSVAGETTDE 49 + VVVS G+TTDE Sbjct: 35 DVVVVVSAMGKTTDE 49 >gnl|CDD|181881 PRK09466, metL, bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional. Length = 810 Score = 24.5 bits (54), Expect = 6.2 Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 38 VVVSVAGETTD 48 VVVS AG+TT+ Sbjct: 45 VVVSAAGKTTN 55 >gnl|CDD|180160 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated. Length = 573 Score = 24.6 bits (54), Expect = 6.3 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Query: 23 RADGWMKEDNTARLSVVVSVAGETTDEEKLREY 55 R DG E+ A VV G D E LR Y Sbjct: 503 REDG--SEEVVA---AVVLEPGAALDPEGLRAY 530 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.128 0.350 Gapped Lambda K H 0.267 0.0681 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,061,569 Number of extensions: 50813 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 132 Number of HSP's successfully gapped: 11 Length of query: 68 Length of database: 5,994,473 Length adjustment: 39 Effective length of query: 29 Effective length of database: 5,151,761 Effective search space: 149401069 Effective search space used: 149401069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.1 bits)