RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >3kga_A MAP kinase-activated protein kinase 2; small molecule inhibitor, 3-aminopyrazole scaffold, scaffold hoping, ATP-site kinase inhibitor, induced FIT; HET: LX9; 2.55A {Homo sapiens} (A:99-299) Length = 201 Score = 26.3 bits (56), Expect = 1.3 Identities = 11/56 (19%), Positives = 22/56 (39%) Query: 10 HFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAK 65 + +R TE W+ + + + + D+E+ + KE + SA A Sbjct: 144 KTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALAT 199 >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} (A:) Length = 256 Score = 26.4 bits (57), Expect = 1.5 Identities = 3/29 (10%), Positives = 7/29 (24%), Gaps = 2/29 (6%) Query: 32 NTARLSVVVSVAGETTDEEKLREYKEFVI 60 ++ S + + VI Sbjct: 3 SSHHHHHHSSGLVPRGS--HMMRKQRIVI 29 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.128 0.350 Gapped Lambda K H 0.267 0.0365 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 496,392 Number of extensions: 16902 Number of successful extensions: 69 Number of sequences better than 10.0: 1 Number of HSP's gapped: 69 Number of HSP's successfully gapped: 4 Length of query: 68 Length of database: 4,956,049 Length adjustment: 35 Effective length of query: 33 Effective length of database: 3,772,874 Effective search space: 124504842 Effective search space used: 124504842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (24.0 bits)