BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781227|ref|YP_003065640.1| hypothetical protein CLIBASIA_05670 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 138 bits (347), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVI 60 MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVI Sbjct: 1 MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVI 60 Query: 61 SAFAKAIS 68 SAFAKAIS Sbjct: 61 SAFAKAIS 68 >gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 23.1 bits (48), Expect = 0.86, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 19/27 (70%) Query: 41 SVAGETTDEEKLREYKEFVISAFAKAI 67 S++ + D+E++R K +V+S +KAI Sbjct: 45 SMSSDLLDQEEVRTLKIYVVSTGSKAI 71 >gi|254781171|ref|YP_003065584.1| hypothetical protein CLIBASIA_05390 [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Score = 22.3 bits (46), Expect = 1.6, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 16/29 (55%) Query: 37 SVVVSVAGETTDEEKLREYKEFVISAFAK 65 S+++ + TTD E EF+++ F + Sbjct: 22 SILIGIFSGTTDYVIFNETAEFIVNVFVR 50 >gi|254781020|ref|YP_003065433.1| isopentenyl pyrophosphate isomerase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 4 VKLGVKHFDTRKRGRTTEIRAD 25 +K G+++FD RG T+ R + Sbjct: 204 LKSGIRYFDIAGRGGTSWSRIE 225 >gi|254780460|ref|YP_003064873.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 20.4 bits (41), Expect = 6.5, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 16 RGRTTEIRADGWMK 29 RGR ADGW+K Sbjct: 136 RGRVVLGAADGWVK 149 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.0 bits (40), Expect = 8.0, Method: Composition-based stats. Identities = 6/9 (66%), Positives = 8/9 (88%) Query: 6 LGVKHFDTR 14 +G+KHFD R Sbjct: 298 IGIKHFDER 306 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.128 0.350 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,143 Number of Sequences: 1233 Number of extensions: 1064 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 68 length of database: 328,796 effective HSP length: 39 effective length of query: 29 effective length of database: 280,709 effective search space: 8140561 effective search space used: 8140561 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)