BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] gi|254040905|gb|ACT57701.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] gi|317120735|gb|ADV02557.1| hypothetical protein SC2_gp180 [Liberibacter phage SC2] gi|317120796|gb|ADV02617.1| hypothetical protein SC2_gp180 [Candidatus Liberibacter asiaticus] Length = 87 Score = 176 bits (447), Expect = 7e-43, Method: Composition-based stats. Identities = 87/87 (100%), Positives = 87/87 (100%) Query: 1 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI 60 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI Sbjct: 1 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI 60 Query: 61 IDELVKGERNKWRQSDNPDDDVCEVCQ 87 IDELVKGERNKWRQSDNPDDDVCEVCQ Sbjct: 61 IDELVKGERNKWRQSDNPDDDVCEVCQ 87 >gi|332526209|ref|ZP_08402342.1| hypothetical protein RBXJA2T_10134 [Rubrivivax benzoatilyticus JA2] gi|332110047|gb|EGJ10675.1| hypothetical protein RBXJA2T_10134 [Rubrivivax benzoatilyticus JA2] Length = 229 Score = 37.3 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 36 EDILRHIELEAKDSANELLKPLRKIIDELVKGE-RNKWRQS 75 EDI+ H L D A LL PLR++++E ++G+ WRQ+ Sbjct: 184 EDIVVHRFLHGDDPAQRLLNPLRRLVEEGLRGDAMAHWRQA 224 >gi|228472665|ref|ZP_04057425.1| nucleoid-associated protein NdpA [Capnocytophaga gingivalis ATCC 33624] gi|228276078|gb|EEK14834.1| nucleoid-associated protein NdpA [Capnocytophaga gingivalis ATCC 33624] Length = 346 Score = 33.9 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 3/83 (3%) Query: 4 TPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDE 63 T W + + LT D+ + L GL +S ++ I+++ K+++ E L + IDE Sbjct: 164 TDWKAIENEDLT---TDRKTYLSFVKGLKDISLYFMQFIDVDNKNTSTESTNRLLRAIDE 220 Query: 64 LVKGERNKWRQSDNPDDDVCEVC 86 K E + DDVC C Sbjct: 221 FAKREGWDKERKIQRQDDVCSYC 243 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.317 0.137 0.409 Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 833,461,915 Number of Sequences: 14124377 Number of extensions: 28080619 Number of successful extensions: 93141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 93137 Number of HSP's gapped (non-prelim): 5 length of query: 87 length of database: 4,842,793,630 effective HSP length: 57 effective length of query: 30 effective length of database: 4,037,704,141 effective search space: 121131124230 effective search space used: 121131124230 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 76 (33.9 bits)