RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >gnl|CDD|37292 KOG2081, KOG2081, KOG2081, Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport]. Length = 559 Score = 25.6 bits (56), Expect = 2.9 Identities = 14/81 (17%), Positives = 29/81 (35%) Query: 6 WNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELV 65 W P F+++ +V IL L + E+ + +E + L + +++ Sbjct: 96 WVNPIFELVRALSNKHPAVPILLEILKVLPEETRDIRLTVGANRRHEFIDELAAQVSKVL 155 Query: 66 KGERNKWRQSDNPDDDVCEVC 86 + +SD D E Sbjct: 156 VFLSDLLERSDLKSSDDLEQV 176 >gnl|CDD|34476 COG4867, COG4867, Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 652 Score = 25.0 bits (54), Expect = 5.1 Identities = 12/46 (26%), Positives = 26/46 (56%) Query: 40 RHIELEAKDSANELLKPLRKIIDELVKGERNKWRQSDNPDDDVCEV 85 R EL +++ + L+ ++K++DE V ER + ++ + D E+ Sbjct: 74 RRRELLRRNNLDGTLQEIKKLLDEAVLAERKELARALDDDARFAEL 119 >gnl|CDD|30391 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]. Length = 323 Score = 24.2 bits (52), Expect = 9.5 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Query: 26 ILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVKGER--NKWRQSDNPDDDVC 83 +L L V + + H+EL + + L+ LRK + +KG + R++ N +D Sbjct: 249 LLPPTLAEVLDILREHLELLLEYYGKKGLRRLRKHLGYYLKGLPGARELRRALNKAEDGA 308 Query: 84 EV 85 EV Sbjct: 309 EV 310 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0728 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,071,615 Number of extensions: 45702 Number of successful extensions: 143 Number of sequences better than 10.0: 1 Number of HSP's gapped: 143 Number of HSP's successfully gapped: 11 Length of query: 87 Length of database: 6,263,737 Length adjustment: 56 Effective length of query: 31 Effective length of database: 5,053,633 Effective search space: 156662623 Effective search space used: 156662623 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)