RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Length = 255 Score = 26.3 bits (57), Expect = 1.9 Identities = 6/35 (17%), Positives = 15/35 (42%) Query: 32 GTVSEDILRHIELEAKDSANELLKPLRKIIDELVK 66 T S L + A+ +L+ ++ + ++V Sbjct: 218 ATFSRAQLNELLDAAEQGIFQLIDIQKEALGDIVS 252 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 26.1 bits (57), Expect = 2.2 Identities = 11/77 (14%), Positives = 26/77 (33%), Gaps = 16/77 (20%) Query: 14 LTRRIADQDS---VLILRLGLGTVSEDILRHIELEA------KDSANELLKPLRKIID-- 62 ++ + +L L L L ++ A +++ L+K +++I Sbjct: 68 VSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVK-TKELIKNY 126 Query: 63 ----ELVKGERNKWRQS 75 + K +K S Sbjct: 127 ITARIMAKRPFDKKSNS 143 >1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 Score = 25.0 bits (54), Expect = 3.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 40 RHIELEAKDSANELLKPLRKIID 62 HI + K +A E+ K L+K Sbjct: 8 SHILVADKKTAEEVEKKLKKGEK 30 >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalanine catabolism; HET: PLP; 2.30A {Homo sapiens} Length = 427 Score = 25.1 bits (53), Expect = 4.2 Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Query: 29 LGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVKGERNKWRQSDNPDDDV 82 + LGT + + D A + P+R I+D + + NP+ + Sbjct: 11 VDLGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNM--------KVKPNPNKTM 56 >1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} SCOP: d.26.1.1 PDB: 1fjd_A Length = 96 Score = 25.2 bits (55), Expect = 4.2 Identities = 6/20 (30%), Positives = 9/20 (45%) Query: 40 RHIELEAKDSANELLKPLRK 59 RHI E E ++ L+ Sbjct: 6 RHILCEKHGKIMEAMEKLKS 25 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 25.0 bits (53), Expect = 4.4 Identities = 7/15 (46%), Positives = 10/15 (66%), Gaps = 1/15 (6%) Query: 42 IELEAKDSANEL-LK 55 ++L A DSA L +K Sbjct: 29 LKLYADDSAPALAIK 43 >2i39_A Protein N1, N1L protein; all alpha, viral protein; 2.20A {Vaccinia virus} PDB: 2uxe_A Length = 137 Score = 24.9 bits (54), Expect = 4.9 Identities = 12/60 (20%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Query: 7 NGPKFDVLTRRIADQDSVLILRLGL-GTVSEDILRHIELEAKDSANELLKPLRKIIDELV 65 +GP D L + + + + + + + V+ DI E+ ++S L + + D+L+ Sbjct: 72 DGPLLDRLNQPVNNIEDAKRM-IAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLM 130 >1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 Score = 24.9 bits (54), Expect = 5.2 Identities = 6/23 (26%), Positives = 13/23 (56%) Query: 40 RHIELEAKDSANELLKPLRKIID 62 HI ++ + A +LL+ ++ D Sbjct: 7 LHILVKEEKLALDLLEQIKNGAD 29 >1ffg_B Chemotaxis protein CHEA; doubly wound (beta/alpha)5 fold, transferase/signaling protein complex; 2.10A {Escherichia coli} SCOP: d.58.24.1 PDB: 1a0o_B 1fwp_A 1ffs_B 1ffw_B Length = 134 Score = 24.3 bits (52), Expect = 6.9 Identities = 11/50 (22%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Query: 38 ILRHIELEAKDSANELLKPLRKIID-ELVKGERNKWRQSDNPDDDVCEVC 86 IL ++ D E L L + D + D +DD+ V Sbjct: 40 ILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVL 89 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0439 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 788,541 Number of extensions: 31242 Number of successful extensions: 157 Number of sequences better than 10.0: 1 Number of HSP's gapped: 157 Number of HSP's successfully gapped: 23 Length of query: 87 Length of database: 5,693,230 Length adjustment: 55 Effective length of query: 32 Effective length of database: 4,359,810 Effective search space: 139513920 Effective search space used: 139513920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.8 bits)