RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Length = 92 Score = 24.6 bits (53), Expect = 2.3 Identities = 6/23 (26%), Positives = 13/23 (56%) Query: 40 RHIELEAKDSANELLKPLRKIID 62 HI ++ + A +LL+ ++ D Sbjct: 7 LHILVKEEKLALDLLEQIKNGAD 29 >d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Length = 96 Score = 23.9 bits (51), Expect = 3.7 Identities = 6/20 (30%), Positives = 9/20 (45%) Query: 40 RHIELEAKDSANELLKPLRK 59 RHI E E ++ L+ Sbjct: 6 RHILCEKHGKIMEAMEKLKS 25 >d1jcua_ d.115.1.1 (A:) Hypothetical protein MTH1692 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 208 Score = 23.4 bits (49), Expect = 6.2 Identities = 6/20 (30%), Positives = 10/20 (50%) Query: 22 DSVLILRLGLGTVSEDILRH 41 + +LR G G + +LR Sbjct: 185 NPPRVLRRGKGPLDPVLLRG 204 >d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Score = 22.8 bits (48), Expect = 7.5 Identities = 6/37 (16%), Positives = 13/37 (35%), Gaps = 1/37 (2%) Query: 34 VSEDILRHIELEAKDSANELLKPLRKIIDELVKGERN 70 + ED++R +E + E+ + E Sbjct: 6 IYEDLMR-LESVPTPPKMTEYDKRCCCLREIQQTEEK 41 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.137 0.409 Gapped Lambda K H 0.267 0.0680 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 340,854 Number of extensions: 13530 Number of successful extensions: 48 Number of sequences better than 10.0: 1 Number of HSP's gapped: 48 Number of HSP's successfully gapped: 18 Length of query: 87 Length of database: 2,407,596 Length adjustment: 52 Effective length of query: 35 Effective length of database: 1,693,636 Effective search space: 59277260 Effective search space used: 59277260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.0 bits)