BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] (87 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781228|ref|YP_003065641.1| hypothetical protein CLIBASIA_05675 [Candidatus Liberibacter asiaticus str. psy62] Length = 87 Score = 177 bits (448), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 87/87 (100%), Positives = 87/87 (100%) Query: 1 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI 60 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI Sbjct: 1 MTNTPWNGPKFDVLTRRIADQDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKI 60 Query: 61 IDELVKGERNKWRQSDNPDDDVCEVCQ 87 IDELVKGERNKWRQSDNPDDDVCEVCQ Sbjct: 61 IDELVKGERNKWRQSDNPDDDVCEVCQ 87 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 23.1 bits (48), Expect = 0.88, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 20/38 (52%) Query: 50 ANELLKPLRKIIDELVKGERNKWRQSDNPDDDVCEVCQ 87 AN + PLR +++++ + + SD DD V V + Sbjct: 1161 ANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAE 1198 >gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Score = 22.3 bits (46), Expect = 1.4, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query: 21 QDSVLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDELVK 66 QD+VL++ L +SED++ L+A + KP+ + I +L K Sbjct: 182 QDAVLMVELEANQLSEDVV----LDAIIFGHNECKPVIEAISKLAK 223 Score = 20.0 bits (40), Expect = 6.9, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 17 RIADQDS---VLILRLGLGTVSEDILRHIELEAKDSANELLKPLRKIIDE 63 ++A DS + + + +G +SE+I+ +AK +L + K++ E Sbjct: 492 KVAGTDSGITAMQMDMKIGGISENIMVMALQQAKRGRLHILNEMSKVLSE 541 >gi|254781130|ref|YP_003065543.1| hypothetical protein CLIBASIA_05160 [Candidatus Liberibacter asiaticus str. psy62] Length = 378 Score = 22.3 bits (46), Expect = 1.5, Method: Composition-based stats. Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 1 MTNTPWNGPKFD 12 M+NTP N KFD Sbjct: 367 MSNTPLNSQKFD 378 >gi|254781013|ref|YP_003065426.1| phage-associated protein [Candidatus Liberibacter asiaticus str. psy62] Length = 302 Score = 21.6 bits (44), Expect = 2.4, Method: Composition-based stats. Identities = 7/20 (35%), Positives = 13/20 (65%) Query: 61 IDELVKGERNKWRQSDNPDD 80 + E+V+ E WR+ +P+D Sbjct: 124 LQEIVQEENKTWRRLYDPND 143 >gi|254780496|ref|YP_003064909.1| integration host factor subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 114 Score = 19.6 bits (39), Expect = 9.5, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 36 EDILRHIELEAKDSANELLKPLRKIIDELVKGE 68 + I + L KDS + +I D V+GE Sbjct: 12 KSISKEFGLSRKDSTRFVTTLFNEICDSAVRGE 44 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.137 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,741 Number of Sequences: 1233 Number of extensions: 1937 Number of successful extensions: 13 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 87 length of database: 328,796 effective HSP length: 56 effective length of query: 31 effective length of database: 259,748 effective search space: 8052188 effective search space used: 8052188 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 31 (16.5 bits)