HHsearch alignment for GI: 255764461 and conserved domain: COG0162

>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis].
Probab=93.75  E-value=0.031  Score=35.61  Aligned_cols=74  Identities=22%  Similarity=0.319  Sum_probs=39.7

Q ss_pred             CCEEEEECCCCCCCC-CCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCC--CCCHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             881799788899998-8322247897899999999885898036236437--0227999999983999899999999999
Q gi|255764461|r    4 REKLYISTAIAYPNA-QPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTD--EHGQKIAKAAQNAGVTTKVFVDQNSRNF   80 (511)
Q Consensus         4 ~~~~~vt~~~Py~ng-~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D--~hg~~i~~~A~~~g~~p~e~~~~~~~~~   80 (511)
T Consensus        32 ~~~~Y~GfD---PTa~slHlGhlv~l---~kL~~f-Q~aGh~~ivLigd~ta~IgDps-Gk~e~r~~l~~e~v~~n~~~i  103 (401)
T COG0162          32 PLRVYIGFD---PTAPSLHLGHLVPL---MKLRRF-QDAGHKPIVLIGDATAMIGDPS-GKSEERKLLTRETVLENAETI  103 (401)
T ss_pred             CCEEEEEEC---CCCCCCCHHHHHHH---HHHHHH-HHCCCEEEEEECCCCEECCCCC-CCHHHHHHCCHHHHHHHHHHH
T ss_conf             944999537---89875336668999---999999-9879918999644402427988-888887530499999999999


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|255764461|r   81 RDMAD   85 (511)
Q Consensus        81 ~~~~~   85 (511)
T Consensus       104 ~~ql~  108 (401)
T COG0162         104 KKQLG  108 (401)
T ss_pred             HHHHC
T ss_conf             99962