HHsearch alignment for GI: 255764461 and conserved domain: PRK00260

>PRK00260 cysS cysteinyl-tRNA synthetase; Validated.
Probab=100.00  E-value=1.8e-44  Score=347.65  Aligned_cols=342  Identities=23%  Similarity=0.333  Sum_probs=239.2

Q ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEC---CCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             881799788899998832224789789999999988589803623---64370227999999983999899999999999
Q gi|255764461|r    4 REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFT---TGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNF   80 (511)
Q Consensus         4 ~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~---~g~D~hg~~i~~~A~~~g~~p~e~~~~~~~~~   80 (511)
T Consensus        23 ~v~~Y~CGPTVY--d~~HiG~~r~~v~~D~l~R~l~~~g~~v~~v~NiTDidD---Kii~~a~~~~~~~~~~~~~~~~~f   97 (460)
T PRK00260         23 KVKMYVCGPTVY--DYAHIGHARSFVVFDVLRRYLRYRGYKVTYVRNITDIDD---KIIKRANEEGESIKELTERYIAAF   97 (460)
T ss_pred             EEEEEECCCCCC--CCCCHHCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCHH---HHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             588996798488--873200030899999999999964993499982375419---999999981969999999999999


Q ss_pred             HHHHHHHCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCCCEEC
Q ss_conf             9999980889-886747788889999999988875431022110001011334301556672111222222223320000
Q gi|255764461|r   81 RDMADVLDIS-YDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQW  159 (511)
Q Consensus        81 ~~~~~~~~i~-~D~~~rT~~~~~~~~~~~~~~~l~~~G~iy~~~~~~~y~~~~~~~~~~~~v~~~~~~~~~~~~~~p~~~  159 (511)
T Consensus        98 ~~d~~~L~i~~p~~~~r~t--~~i~~~i~~i~~l~~~g~aY~~~~~vyFdv~~~~--~YG~Ls~~~-~~~~-~~g~rv~~  171 (460)
T PRK00260         98 HEDMDALGVLRPDIEPRAT--EHIPEIIELIERLIEKGHAYEADGDVYFDVRKFP--DYGKLSGRN-LDDL-QAGARVEV  171 (460)
T ss_pred             HHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHHHHHCCCEEEECCEEEECCCCCC--CHHHCCCCC-CHHH-HCCCCCCC
T ss_conf             9999994899985224301--4799999999999857952884787996355553--303005653-0212-11565676


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             34544344666444443444333321000676545775410345675323433377765786422214646024443220
Q gi|255764461|r  160 MEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL  239 (511)
Q Consensus       160 ~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p~~~~~~~~~wl~~gl~Dw~ISR~~~~WGipiP~~~~~~~YVWfDa~~gY~  239 (511)
T Consensus       172 ----------~-------~~K~~p~DFaLWK~~--------~~ge~~W~----SP-WG~---GRPG--------------  204 (460)
T PRK00260        172 ----------A-------EEKRDPLDFVLWKAA--------KPGEPSWD----SP-WGK---GRPG--------------  204 (460)
T ss_pred             ----------C-------CCCCCCCCHHHCCCC--------CCCCCCCC----CC-CCC---CCCC--------------
T ss_conf             ----------6-------344785532212788--------88887776----98-888---7987--------------


Q ss_pred             CCCCCCCCCCCCCCCCC--CCCHHCCCCCCCCH-HCCHHHHHHHH-HHHHCCCCCCCCCCEEECCCCCCHHHCCCCCCCC
Q ss_conf             01234676543100024--11000045643210-00102477654-3310123233343033058601000002211100
Q gi|255764461|r  240 TTTGYLDNPDGSKAKFW--PADLHVIGKDILRF-HAIYWPAFLLS-ANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIE  315 (511)
Q Consensus       240 s~~~~~~~~~~~~~~~w--~~d~~~~G~Dii~F-h~i~~pa~l~~-~~~~~p~~i~~~g~l~~~G~KMSKS~GN~I~~~e  315 (511)
T Consensus       205 ----WHIECSaM~~~~LG~~~DIH~GG~DL~FPHHEN-EiAQs~a~~~~~~a~yW~H~g~l~i~g~KMSKSlgN~iti~d  279 (460)
T PRK00260        205 ----WHIECSAMSTKYLGETFDIHGGGSDLIFPHHEN-EIAQSEAATGKPFANYWMHNGFVTVNGEKMSKSLGNFFTIRD  279 (460)
T ss_pred             ----CCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCC-HHHHHHHHHCCCCCCEEEEEEEEEECCEEEECCCCCCCCHHH
T ss_conf             ----422637999987599754762452677899610-999998864898652456510576367175035787001999


Q ss_pred             HHHHCCCCCCCHHHEEECCCCCCCEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             00002211121110000247873011122211100133211022102134556531233210345558955656678999
Q gi|255764461|r  316 VIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCS  395 (511)
Q Consensus       316 ~l~~~g~D~lR~~l~~~~~~~~D~~Fs~~~~~~~~n~~L~~~lgN~~~R~~~f~~k~~~g~ip~~~~~~~~D~~ll~~l~  395 (511)
T Consensus       280 ll~~y~~~~lR~~lLs-~hYR~pl~fs~e~L~~a~~~--l~rl~~~~~~~--------~~~~-----~~~~~-------~  336 (460)
T PRK00260        280 LLKKYDPEVLRFFLLS-AHYRSPLNFSEEALEEAKKA--LERLYNALRNL--------EPAV-----APAGG-------E  336 (460)
T ss_pred             HHHHHCHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHH--HHHHHHHHHHH--------HHCC-----CCCCH-------H
T ss_conf             9987077999999985-46899667799999999999--99999999975--------5402-----55322-------7


Q ss_pred             HHHHHHHHHH-HHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999877-50358999999999999997886541
Q gi|255764461|r  396 RVLQEIRENM-QNQLIHRALAQVISLVSEVDRYFDAQ  431 (511)
Q Consensus       396 ~~~~~v~~a~-e~~~~~~Al~~i~~l~~~~N~yi~~~  431 (511)
T Consensus       337 ~~~~~F~~AL~DDLNTP~Ala~Lfelvk~iN~~l~~~  373 (460)
T PRK00260        337 EFEERFIEAMDDDFNTPEALAVLFELAKEINRLLDAK  373 (460)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             8999999987522786999999999999999875025