HHsearch alignment for GI: 255764461 and conserved domain: PRK00574

>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed.
Probab=99.29  E-value=2.1e-10  Score=96.02  Aligned_cols=268  Identities=18%  Similarity=0.199  Sum_probs=133.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99998832224789789999999988589803623643702279999999839998999999999999999980889886
Q gi|255764461|r   14 AYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDD   93 (511)
Q Consensus        14 Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A~~~g~~p~e~~~~~~~~~~~~~~~~~i~~D~   93 (511)
T Consensus        11 PSPTG~lHiG~~rtAl~n~l~Ar~~--~G~fiLRIEDTD~----------------~R~~~~~~~~I~~~L~wlgl~~DE   72 (489)
T PRK00574         11 PSPTGYLHIGNARTALFNYLFAKHN--NGKFILRIEDTDQ----------------ERNVEGGEESQLENLKWLGIDWDE   72 (489)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             8999842247899999999999964--9989998677898----------------778769999999999987988877


Q ss_pred             CCC---CC----CHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCC-CCHHHHCCCCCCCCCCCCCCCE----E-CC
Q ss_conf             747---78----8889999999988875431022110001011334301-5566721112222222233200----0-03
Q gi|255764461|r   94 FIR---TT----EKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAY-YNDDEVYKGADGQYYNAQHNPV----Q-WM  160 (511)
Q Consensus        94 ~~r---T~----~~~~~~~~~~~~~~l~~~G~iy~~~~~~~y~~~~~~~-~~~~~v~~~~~~~~~~~~~~p~----~-~~  160 (511)
T Consensus        73 ~p~~~g~~gPY~QS~R~~~Y~~~a~~Ll~~G~AY~C-----fct~eel~~~r~~~~~~g~~~~Y~~~cr~l~~~e~~~~~  147 (489)
T PRK00574         73 GPDKGGEYGPYRQSERLDIYQKYADQLLEEGKAYYC-----FCTEEELEAEREKQEARGETPKYDGKCLGLTKEEIEEYE  147 (489)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEC-----CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             877788888835126899999999999974997452-----577999999899997569998787232338988899898


Q ss_pred             -CCCCC--CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             -45443--446664444434443333210006765457754103456753234333777657864222146460244432
Q gi|255764461|r  161 -EEEGY--FFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTN  237 (511)
Q Consensus       161 -~~~~~--f~~l~~~~~~l~~~~~~~~~~~~p~~~~~~~~~wl~~gl~Dw~ISR~~~~WGipiP~~~~~~~YVWfDa~~g  237 (511)
T Consensus       148 ~~g~~~viRfk~p~--~~---------~~~~~D~v~G~i~-~~~~~ldD~Vi~rsD---G~PtYhla~-VVD---D~~M~  208 (489)
T PRK00574        148 AEGIPPVIRFKVPE--NG---------TYSFDDIVKGKIS-FDSSTIGDFVIVKSD---GFPTYNFAV-VVD---DHLME  208 (489)
T ss_pred             HCCCCCEEEEECCC--CC---------EEEEEEECCCCCC-CCCCCCCCEEEEECC---CCEEEEECC-CCC---CCCCC
T ss_conf             56999237653699--87---------1898642367646-575667876888148---980564121-147---51258


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCHHCC-CCC---CCCHHCCHHHHHHHHHHHHCCCCCCCCCCEE-ECCCCCCHHHCCCC-
Q ss_conf             20012346765431000241100004-564---3210001024776543310123233343033-05860100000221-
Q gi|255764461|r  238 YLTTTGYLDNPDGSKAKFWPADLHVI-GKD---ILRFHAIYWPAFLLSANLPLPKKVFSHGFIL-HKGEKISKSLGNVI-  311 (511)
Q Consensus       238 Y~s~~~~~~~~~~~~~~~w~~d~~~~-G~D---ii~Fh~i~~pa~l~~~~~~~p~~i~~~g~l~-~~G~KMSKS~GN~I-  311 (511)
T Consensus       209 ---------------------ITHVIRGedhlsnTpkqi~ly----~Alg~~~P~faH-lPLi~~~dg~KLSKR~g~~~~  262 (489)
T PRK00574        209 ---------------------ITHVIRGEDHISNTPKQIMIY----EAFGWEPPKFGH-MPLILNEDRKKLSKRDGATLQ  262 (489)
T ss_pred             ---------------------CCEEECCHHHHHHHHHHHHHH----HHHCCCCCEEEE-EEEEECCCCCCCCCCCCCHHH
T ss_conf             ---------------------764303521577639999999----982899974785-111378999816666797015


Q ss_pred             CCCCHHHH-CCCCCCCHHHEEECC--CCCCCEECCCCCCCC
Q ss_conf             11000000-221112111000024--787301112221110
Q gi|255764461|r  312 DPIEVIEE-VGVDALRYFLVREIA--CGKDGFYDKDGLKKR  349 (511)
Q Consensus       312 ~~~e~l~~-~g~D~lR~~l~~~~~--~~~D~~Fs~~~~~~~  349 (511)
T Consensus       263 sv~~yre~GylPeAl~NyLa~LGWs~~~~~Eifsl~eli~~  303 (489)
T PRK00574        263 FIEDYRELGYLPEAIFNFIALLGWSPEGEEEIFSLEELIKL  303 (489)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             79999987986669999999807999987465899999864