HHsearch alignment for GI: 255764461 and conserved domain: PRK01611

>PRK01611 argS arginyl-tRNA synthetase; Reviewed.
Probab=99.90  E-value=3e-21  Score=176.14  Aligned_cols=335  Identities=23%  Similarity=0.317  Sum_probs=201.0

Q ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHH--------------------
Q ss_conf             888179978889999883222478978999999998858980362364370227999999--------------------
Q gi|255764461|r    3 EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA--------------------   62 (511)
Q Consensus         3 ~~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A--------------------   62 (511)
T Consensus       116 ~~~kv~VEf~S~Np~kplHvGH~R~aiiGdslaril~~~G~~V~r~~yvnD~G~Qi~~l~~~~~~~~~~~~~~~~l~~~Y  195 (570)
T PRK01611        116 KGKKVVVEYVSANPTGPLHVGHLRSAVIGDALARILEFAGYDVTREYYVNDAGTQIGMLAASLELEEAAAKGLSDLERRY  195 (570)
T ss_pred             CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             99779998448999998623358878999999999998399079999978742799999999999604888706679999


Q ss_pred             ---H------------------HCCCCH------HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHH-HHHHHHHHHH
Q ss_conf             ---9------------------839998------99999999999999998088988674778888999-9999988875
Q gi|255764461|r   63 ---Q------------------NAGVTT------KVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHD-TCRILWKKIS  114 (511)
Q Consensus        63 ---~------------------~~g~~p------~e~~~~~~~~~~~~~~~~~i~~D~~~rT~~~~~~~-~~~~~~~~l~  114 (511)
T Consensus       196 ~~~~~~~~~~~~~~~~~~~~~l~~~~d~~~~~~~~~~~~~~l~~~~~~l~~l~I~fD~~~~E-s~~~~~~~i~~v~~~L~  274 (570)
T PRK01611        196 REAKKEPDEDPEEYAGEYIVKLAAPGDEELEELWRKAVDISLDEIKEDLDRLGVKFDVFFSE-SSLYNDGKVEEVVEDLK  274 (570)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCH-HHHHHCCCHHHHHHHHH
T ss_conf             99850346585455789999987179888999999999999999999999748764421266-88985774499999998


Q ss_pred             HHHCCCCCCHHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             43102211000101133430155667211122222222332000034544344666444443444333321000676545
Q gi|255764461|r  115 DKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRN  194 (511)
Q Consensus       115 ~~G~iy~~~~~~~y~~~~~~~~~~~~v~~~~~~~~~~~~~~p~~~~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p~~~~~  194 (511)
T Consensus       275 ~~~~~~e~dGa~~---------------------------------------~~~~~~g~d-------------------  296 (570)
T PRK01611        275 EKGLLYESDGALW---------------------------------------VRLTEFGDD-------------------  296 (570)
T ss_pred             HCCCEEECCCCEE---------------------------------------EECHHCCCC-------------------
T ss_conf             6795893189689---------------------------------------942110677-------------------


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHCCCCCCC-CHHCC
Q ss_conf             77541034567532343337776578642221464602444322001234676543100024110000456432-10001
Q gi|255764461|r  195 EVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDIL-RFHAI  273 (511)
Q Consensus       195 ~~~~wl~~gl~Dw~ISR~~~~WGipiP~~~~~~~YVWfDa~~gY~s~~~~~~~~~~~~~~~w~~d~~~~G~Dii-~Fh~i  273 (511)
T Consensus       297 ---------~~~~vl~ksD---Gt~--------~Y~t~D--iAy---~~~K~~-~~-~d----~~I~V~g~dq~~hf~~l  345 (570)
T PRK01611        297 ---------EKDRVLQKSD---GTY--------TYFTTD--IAY---HLYKFE-RG-FD----RVIYVVGADHHGHFKRL  345 (570)
T ss_pred             ---------CCCEEEEECC---CCC--------EECHHH--HHH---HHHHHH-HC-CC----EEEEEECCCHHHHHHHH
T ss_conf             ---------7784899159---960--------001468--999---999985-17-88----38999457588899999


Q ss_pred             HHHHHHHHHHHHCCC-CCCCCCCE-E---ECCCCCCHHHCCCCCCCCHHHH----------------------CCCCCCC
Q ss_conf             024776543310123-23334303-3---0586010000022111000000----------------------2211121
Q gi|255764461|r  274 YWPAFLLSANLPLPK-KVFSHGFI-L---HKGEKISKSLGNVIDPIEVIEE----------------------VGVDALR  326 (511)
Q Consensus       274 ~~pa~l~~~~~~~p~-~i~~~g~l-~---~~G~KMSKS~GN~I~~~e~l~~----------------------~g~D~lR  326 (511)
T Consensus       346 -~-~~l~~lG~~~~~~~~l~h~~~~lv~~~~~~kMStR~G~~v~L~dlldea~~~a~~~~~~~~e~~~~ia~~Vg~~Air  423 (570)
T PRK01611        346 -K-AALKALGYDPEKLEVLLHQMVGLVRGGEGVKMSTRAGNVVTLDDLLDEAVERARELVEESEEEKEEIAKAVGIDAVR  423 (570)
T ss_pred             -H-HHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCHHHHH
T ss_conf             -9-99998699963344799999875436867644246787458999999999999987633776788999763410402


Q ss_pred             HHHEEECCCCCCCEECCCCCCCCHHHHHHHHHHHCC-HHHHHHHHHCCCCCCCC-C--C-CCCHHHHHHHHHHHHHHHHH
Q ss_conf             110000247873011122211100133211022102-13455653123321034-5--5-58955656678999999999
Q gi|255764461|r  327 YFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV-SRSVSMILKDYDGMIPT-P--G-AFTESDESILSVCSRVLQEI  401 (511)
Q Consensus       327 ~~l~~~~~~~~D~~Fs~~~~~~~~n~~L~~~lgN~~-~R~~~f~~k~~~g~ip~-~--~-~~~~~D~~ll~~l~~~~~~v  401 (511)
T Consensus       424 y~~L~-~~~~~~~~Fd~d~~l~~~g~--t~~YiQYa~AR~~SIlrK~~~~~~~~~~~~~~l~~~~E~~Li~~l~~fp~vv  500 (570)
T PRK01611        424 YFDLS-RSRDSDYDFDLDLALSFEGN--NPPYVQYAHARICSILRKAAEEGLAAAADLSLLTEEEELELIKKLAEFPEVV  500 (570)
T ss_pred             HHHHC-CCCCCCCEECHHHHHHHCCC--CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             64440-68888822268998632389--8257889999999999863123454434333469989999999998879999


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9877503589999999999999978865418
Q gi|255764461|r  402 RENMQNQLIHRALAQVISLVSEVDRYFDAQK  432 (511)
Q Consensus       402 ~~a~e~~~~~~Al~~i~~l~~~~N~yi~~~~  432 (511)
T Consensus       501 ~~a~~~~~Ph~l~~YL~~La~~Fn~fY~~~~  531 (570)
T PRK01611        501 ESAAEELEPHRIANYLYELAGAFHSFYNACP  531 (570)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999968818999999999999999985198