HHsearch alignment for GI: 255764461 and conserved domain: PRK06039

>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed.
Probab=100.00  E-value=0  Score=693.75  Aligned_cols=480  Identities=24%  Similarity=0.386  Sum_probs=383.7

Q ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHC-CC--------------
Q ss_conf             888179978889999883222478978999999998858980362364370227999999983-99--------------
Q gi|255764461|r    3 EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA-GV--------------   67 (511)
Q Consensus         3 ~~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A~~~-g~--------------   67 (511)
T Consensus        33 ~~~~f~~~dgPPy~nG~lHiGH~~~~tikDii~Ry~rm~G~~V~~~~GwD~hGLPiE~~vek~lgi~~k~~i~~~gi~~F  112 (1042)
T PRK06039         33 GGPEFVFYDGPPFANGLPHYGHLLTRTIKDVVPRYKTMKGYKVERRAGWDTHGLPVELEVEKELGISGKKDIEKYGIEKF  112 (1042)
T ss_pred             CCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHCCHHHH
T ss_conf             99978996789987887214366878999999999873899668989748677899999999847667642655289999


Q ss_pred             --CHHHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCCHHHHCC
Q ss_conf             --98999999999999999980889886--74778888999999998887543102211000101133430155667211
Q gi|255764461|r   68 --TTKVFVDQNSRNFRDMADVLDISYDD--FIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYK  143 (511)
Q Consensus        68 --~p~e~~~~~~~~~~~~~~~~~i~~D~--~~rT~~~~~~~~~~~~~~~l~~~G~iy~~~~~~~y~~~~~~~~~~~~v~~  143 (511)
T Consensus       113 ~~~cr~~~~~~~~~~~~~~~rlG~~~Dw~~~y~T~d~~y~e~v~~~F~~L~ekGliYrg~~~V~wcp~~~T~Lad~Ev~~  192 (1042)
T PRK06039        113 NEECRESVLRYTDEWEEYTERLGRWVDFDNPYKTMDNSYMESVWWALKQLYDKGLLYEGYRVVPYCPRCETPLSNHEVRQ  192 (1042)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCCHHHHHHHHHHHHHHHHCCCEEECCCEECCCCCCCCCCHHHHHHC
T ss_conf             99999999999999999999818205268982768988999999999999987998962713254898898811867305


Q ss_pred             C-----------------C-------------------------------------------------------------
Q ss_conf             1-----------------2-------------------------------------------------------------
Q gi|255764461|r  144 G-----------------A-------------------------------------------------------------  145 (511)
Q Consensus       144 ~-----------------~-------------------------------------------------------------  145 (511)
T Consensus       193 ~Y~~~~~~s~~vkF~l~~~~~~~l~iwTTrPwTl~~n~avaV~Pd~~Y~~v~~~~~~e~~i~a~~~~~~~~~~~~~~~~~  272 (1042)
T PRK06039        193 GYKEVKDPSVYVKFKLKGEENEYLLAWTTTPWTLPSNLALAVGPDIDYVKVRDKGGGEVYILAEALLEKVLKKEGGEEYE  272 (1042)
T ss_pred             CCEEEECCEEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEECCCCCEEEEEECCCCEEEEEEHHHHHHHHHHCCCCCEE
T ss_conf             74441446499999975279847998658875111135999868763699984489759998088899998551675407


Q ss_pred             ---------------------------------------------------------------------------CC---
Q ss_conf             ---------------------------------------------------------------------------22---
Q gi|255764461|r  146 ---------------------------------------------------------------------------DG---  147 (511)
Q Consensus       146 ---------------------------------------------------------------------------~~---  147 (511)
T Consensus       273 v~~~~~G~~L~G~~y~~p~~~~~~~~~~~~~~Vi~~d~V~~~~GTG~Vh~aPahg~~D~~~~~~~~l~~~~~vd~~G~~~  352 (1042)
T PRK06039        273 VLETFKGEELEGLRYEPPFPYFVPEDEENAFRVVAADFVTTEDGTGIVHIAPAFGEDDFEVGKKYGLPVVCPVDDNGRFT  352 (1042)
T ss_pred             EEEEEECHHHCCCEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             88775124307888778864323667787427995472057889742896788988999999983998666317755334


Q ss_pred             --------------------------------------CCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             --------------------------------------222223320000345443446664444434443333210006
Q gi|255764461|r  148 --------------------------------------QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILP  189 (511)
Q Consensus       148 --------------------------------------~~~~~~~~p~~~~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p  189 (511)
T Consensus       353 ~~~~~~~G~~v~da~~~Ii~~L~~~g~l~~~~~~~Hsyp~cwR~~~pli~~~~~QWFi~~~~~k~~~l~~~~~-i~w-~P  430 (1042)
T PRK06039        353 EEVPDYAGKFVKDADKEIIRDLKERGLLFKAETYEHSYPHCWRCDTPLIYRAVESWFIRVTKIKDRMLELNQK-INW-YP  430 (1042)
T ss_pred             CCCCCCCCCEEECCHHHHHHHHHHCCCCCCCCCEECCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHC-CEE-EC
T ss_conf             6443517936530209999999866752246633557874257798148633262776557679999998602-147-34


Q ss_pred             HHHHH-HHHHHCCCCCCCCCCCCCCCCCCCCCCCC---------------------------------------------
Q ss_conf             76545-77541034567532343337776578642---------------------------------------------
Q gi|255764461|r  190 IERRN-EVISFVKSGLKDLSLSRKTFDWGIKIPDD---------------------------------------------  223 (511)
Q Consensus       190 ~~~~~-~~~~wl~~gl~Dw~ISR~~~~WGipiP~~---------------------------------------------  223 (511)
T Consensus       431 ~~~~~~rf~~wl~n-~~DW~ISRQR-~WG~PIPvw~~~~~~~~~v~~s~~el~~~~~~~~~~dlhrp~iD~v~~~~~~~~  508 (1042)
T PRK06039        431 EHIKDGRFGKWLEN-ARDWAISRNR-YWGTPLPIWRCEDCGRIDVIGSIEELEEDFGVPKPIDLHRPYIDEVTLPCPDCG  508 (1042)
T ss_pred             CCCCCCHHHHHHHH-CCCHHHHCCC-CCCCCCEEEEECCCCCEEECCCHHHHHHHCCCCCCCHHCCCCCCCEEECCCCCC
T ss_conf             52320069999863-6331100023-457754069967999667028699998760888830102454550565589986


Q ss_pred             -----CCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHCCCCCCCC--HHCCHHHHHHHHHHHHCCCCCCCCCCE
Q ss_conf             -----2214646024443220012346765431000241100004564321--000102477654331012323334303
Q gi|255764461|r  224 -----PQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWPAFLLSANLPLPKKVFSHGFI  296 (511)
Q Consensus       224 -----~~~~~YVWfDa~~gY~s~~~~~~~~~~~~~~~w~~d~~~~G~Dii~--Fh~i~~pa~l~~~~~~~p~~i~~~g~l  296 (511)
T Consensus       509 ~~~~r~~DvlD~WfdSg~~p~a~~~~p~~~~~~f~~~~PaD~i~eg~Dq~RgWF~sl~~~s~~~-~~~~Pfk~v~~~G~V  587 (1042)
T PRK06039        509 TGMRRVPDVLDVWFDSGSMPYAQLHYPFENKELFEEHFPADFIVEGIDQTRGWFYTLLALSTAL-FDRPPYKNVIVHGHV  587 (1042)
T ss_pred             CCCCCCCCCEEEEEECCCCCEEEECCCCCCHHHHHCCCCCEEEEECCCHHEEEEEEEEEEEEEE-CCCCCCCEEEEEEEE
T ss_conf             2103056421237635874406977864366666215864444523222101436000321223-484200258995038


Q ss_pred             EE-CCCCCCHHHCCCCCCCCHHHHCCCCCCCHHHEEECCCCCCCEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHHCCCC
Q ss_conf             30-58601000002211100000022111211100002478730111222111001332110221021345565312332
Q gi|255764461|r  297 LH-KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDG  375 (511)
Q Consensus       297 ~~-~G~KMSKS~GN~I~~~e~l~~~g~D~lR~~l~~~~~~~~D~~Fs~~~~~~~~n~~L~~~lgN~~~R~~~f~~k~~~g  375 (511)
T Consensus       588 ld~~G~KMSKS~GNvidP~~vi~~yGADalRl~l~~~~~~~~d~~f~~~~v~e~~r~-~~~~lwN-~~rF~~~-y~~ld~  664 (1042)
T PRK06039        588 LDEDGQKMSKSLGNYVDPFEVFDKYGADALRWYLLSSSVPWEDLRFSEDGIREVVRK-FLLPLWN-VYSFFAL-YANLDG  664 (1042)
T ss_pred             ECCCCEECCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCEEECHHHHHHHHHH-HHHHHHH-HHHHHHH-HHHCCC
T ss_conf             736864803367886897999886082799999996677555615779999999999-9999999-9999987-421027


Q ss_pred             CCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH-HHHHHHHHHCC--CHHHCCCHHHHHHH
Q ss_conf             103-----45558955656678999999999987750358999999999999-99788654187--01216999999999
Q gi|255764461|r  376 MIP-----TPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS-EVDRYFDAQKP--WELKKTNPDRASTV  447 (511)
Q Consensus       376 ~ip-----~~~~~~~~D~~ll~~l~~~~~~v~~a~e~~~~~~Al~~i~~l~~-~~N~yi~~~~P--W~l~k~d~~~~~~v  447 (511)
T Consensus       665 f~~~~~~~~~~~~~~~DrWils~l~~~i~~v~~~~~~y~~~~a~~~l~~Fi~dLs~wYi~~~r~R~~~~~-~~~~k-~~A  742 (1042)
T PRK06039        665 FDPNEAEEALDSRNELDRWILSRLNSLVKEVTEALDNYDITKAARAIRDFVDDLSNWYIRRSRRRFWKEE-DDPDK-LAA  742 (1042)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHH-HHH
T ss_conf             9954355563216687899999999999999999972459999999999998877999999778760368-97899-999


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC--CCCCCHHHHCCC
Q ss_conf             999999999999985432248999999984988--000795551012
Q gi|255764461|r  448 LYVTVEVIRQLAILLQAFVPKLANKIFDILFVA--DENRCFQSLDQR  492 (511)
Q Consensus       448 l~~~l~~l~~l~ilL~Pi~P~~ae~i~~~Lg~~--~~~~~~~~~~~~  492 (511)
T Consensus       743 ~~tL~~vL~~l~~llAP~~PFitEeiyq~L~~~~~~eSVHl~~~P~~  789 (1042)
T PRK06039        743 YNTLYTVLETLSRLMAPFTPFIAEEIYQNLKGETGPESVHLADWPEV  789 (1042)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCC
T ss_conf             99999999999999650136769999984455899951798146776