HHsearch alignment for GI: 255764461 and conserved domain: TIGR00398

>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Methionyl-tRNA synthetase (6.1.1.10 from EC) is an alpha 2 dimer that belongs to class Ia. In some species (archaea, eubacteria and eukaryota) a coding sequence, similar to the C-term end of MetRS, is present as an independent gene which is a tRNA binding domain as a dimer. In eubacteria, MetRS can also be splitted in two sub-classes corresponding to the presence of one or two CXXC domain specific to zinc binding. The crystal structures of a number of methionyl-tRNA synthases are known , , .; GO: 0000166 nucleotide binding, 0004825 methionine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006431 methionyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=1099.12  Aligned_cols=503  Identities=39%  Similarity=0.743  Sum_probs=456.3

Q ss_pred             EEEECCCCCCCCCCCHHHHH-HHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHH
Q ss_conf             79978889999883222478-978999999998858980362364370227999999983999-8999999999999999
Q gi|255764461|r    7 LYISTAIAYPNAQPHIGHAY-EMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT-TKVFVDQNSRNFRDMA   84 (511)
Q Consensus         7 ~~vt~~~Py~ng~lHlGH~~-~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A~~~g~~-p~e~~~~~~~~~~~~~   84 (511)
T Consensus         1 ~liTtpl~Y~Ng~pHlGH~~st~~~AD~~~RY~~~~G~~v~f~cGTDEHG~kI~~~A~~~g~tqP~~~vd~~~~~f~~~~   80 (573)
T TIGR00398         1 ILITTPLPYANGKPHLGHAYSTTILADVYARYKRLRGYEVLFVCGTDEHGTKIELKAEQEGLTQPKELVDKYHEEFKKLW   80 (573)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             91005776678711210366777899999999852897478985134468788886987089964899999999999999


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCCHH-----HHCCCC--------CCCCCC
Q ss_conf             9808898867477888899999999888754310221100010113343015566-----721112--------222222
Q gi|255764461|r   85 DVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDD-----EVYKGA--------DGQYYN  151 (511)
Q Consensus        85 ~~~~i~~D~~~rT~~~~~~~~~~~~~~~l~~~G~iy~~~~~~~y~~~~~~~~~~~-----~v~~~~--------~~~~~~  151 (511)
T Consensus        81 ~~lnI~fD~F~RTTd~~H~~~v~~~f~~L~~nGyIY~~~~~g~YC~~c~~Fl~dr~~~~~yv~g~CP~c~~~~~~gd~c~  160 (573)
T TIGR00398        81 KWLNISFDRFIRTTDEEHKEIVQKIFQKLLENGYIYEKEIKGLYCPECESFLPDRKLVDDYVEGTCPKCGSEDARGDHCE  160 (573)
T ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             87284567654676888899999999998753774110035323475665362232001334674886887777787755


Q ss_pred             CCC---CCEECC--------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCH-HHHHHHH-HHHCCCCCCCCCCCCC
Q ss_conf             233---200003--------------45443446664444434443333210006-7654577-5410345675323433
Q gi|255764461|r  152 AQH---NPVQWM--------------EEEGYFFRLSAYQDKLLSYYESHPEFILP-IERRNEV-ISFVKSGLKDLSLSRK  212 (511)
Q Consensus       152 ~~~---~p~~~~--------------~~~~~f~~l~~~~~~l~~~~~~~~~~~~p-~~~~~~~-~~wl~~gl~Dw~ISR~  212 (511)
T Consensus       161 ~Cg~~leP~~Li~P~c~~~~~~~~~~~~~hyFf~L~~~~~~l~~~~~~~~~~~~~~~~~~n~~~~~~~~~GL~D~~ItR~  240 (573)
T TIGR00398       161 VCGRHLEPFELINPRCVICKNKPELRDSEHYFFRLSAFEKELEEWIKKNPESKSPASNVKNVAKQNWIKGGLKDLAITRD  240 (573)
T ss_pred             CCCCCCCCCHHCCCCEEEECCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEECC
T ss_conf             46553685001187025548800251354522353688899999861488424218999999889985068743011036


Q ss_pred             CCC--CCCCCCCC--CCCCCCCCHHHHHHHHCCCCCCCCC---CCCCCCCCCCC------HHCCCCCCCCHHCCHHHHHH
Q ss_conf             377--76578642--2214646024443220012346765---43100024110------00045643210001024776
Q gi|255764461|r  213 TFD--WGIKIPDD--PQYIMYVWIDALTNYLTTTGYLDNP---DGSKAKFWPAD------LHVIGKDILRFHAIYWPAFL  279 (511)
Q Consensus       213 ~~~--WGipiP~~--~~~~~YVWfDa~~gY~s~~~~~~~~---~~~~~~~w~~d------~~~~G~Dii~Fh~i~~pa~l  279 (511)
T Consensus       241 ~~~lkWG~pvP~~~~p~~~~YVW~DAl~gYiss~~~~~~~~~~~~~~~~~W~~~~~~~~~~HfIGKDI~~FH~iyWPa~L  320 (573)
T TIGR00398       241 LVDLKWGIPVPNDGAPNKVVYVWFDALIGYISSLKALGIEKGLTEDWKKWWNNNSEDAELIHFIGKDIVRFHTIYWPAML  320 (573)
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             44121153178989879679987203456999975213356875789986268886502788842412020333445888


Q ss_pred             HHHH--HHCCCCCCCCCCEEECCCCCCHHHCCCCCCCC-HHHH-CCCCCCCHHHEEECCCCCCCEECCCCCCCCHHHHHH
Q ss_conf             5433--10123233343033058601000002211100-0000-221112111000024787301112221110013321
Q gi|255764461|r  280 LSAN--LPLPKKVFSHGFILHKGEKISKSLGNVIDPIE-VIEE-VGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA  355 (511)
Q Consensus       280 ~~~~--~~~p~~i~~~g~l~~~G~KMSKS~GN~I~~~e-~l~~-~g~D~lR~~l~~~~~~~~D~~Fs~~~~~~~~n~~L~  355 (511)
T Consensus       321 ~~~~eN~~lP~q~~~hGyl~~eG~KMSKS~G~vv~~~~~~~~~~~g~D~lRYYl~~~~~~~~D~~F~~~~f~~r~N~~L~  400 (573)
T TIGR00398       321 MGLGENLPLPTQVFAHGYLTVEGQKMSKSLGNVVDPEDDLLARGYGADILRYYLLKEVPLGKDGDFSWEDFVERVNADLA  400 (573)
T ss_pred             HHCCCHHHHHHHHEEEEEEEECCEEECCCCCCEECHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             51121002121324301688478443232475323217876447880578889986424344765688999999768877


Q ss_pred             HHHHHCCHHHHHHHHHCCCCCCCCCCC--------------CCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             102210213455653123321034555--------------895565667899999999998775035899999999999
Q gi|255764461|r  356 NGIGNLVSRSVSMILKDYDGMIPTPGA--------------FTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV  421 (511)
Q Consensus       356 ~~lgN~~~R~~~f~~k~~~g~ip~~~~--------------~~~~D~~ll~~l~~~~~~v~~a~e~~~~~~Al~~i~~l~  421 (511)
T Consensus       401 n~lGNl~nR~~~f~~k~f~g~~~~~~~~nfqfqeifqneP~l~~~~~~l~~~~~~~~~~~~~~~~~~~f~~Al~~~~~L~  480 (573)
T TIGR00398       401 NDLGNLLNRTLGFIKKYFNGVLPSVDETNFQFQEIFQNEPKLTEEDKELLKKINETLEQIDKALESFEFRKALEEILKLA  480 (573)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             65558999999999887356211010123456666503765223566899999999999999886203899999999999


Q ss_pred             HHHHHHHHHHCCCHHHCCCHHHHHHHHHHHHH---HHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCHHH--HCCCCCCC
Q ss_conf             99978865418701216999999999999999---99999998543224899999998498800079555--10126899
Q gi|255764461|r  422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVE---VIRQLAILLQAFVPKLANKIFDILFVADENRCFQS--LDQRLKPG  496 (511)
Q Consensus       422 ~~~N~yi~~~~PW~l~k~d~~~~~~vl~~~l~---~l~~l~ilL~Pi~P~~ae~i~~~Lg~~~~~~~~~~--~~~~l~~~  496 (511)
T Consensus       481 ~~gNkyi~~~~PW~l~k~~-~~~~~l~~~~~~~~e~~~~l~~Ll~P~~P~~~~k~~~~~n~~~~~~~~~~~~f~~~~~~~  559 (573)
T TIGR00398       481 DRGNKYIDDNEPWELAKQS-EKLKELLAVCSLVAELIRVLSILLYPFMPKLSEKILKLLNFELEFDNIRDSIFALKLLEG  559 (573)
T ss_pred             HHHHHHHHHCCCCEEECCC-HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9861476523887132570-679999999999999999999984241024789999983887013236777776556530


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             733687776432349
Q gi|255764461|r  497 FMLHKTFDPIFPRFL  511 (511)
Q Consensus       497 ~~i~~~~epLF~Ri~  511 (511)
T Consensus       560 ~~~~~-~e~lf~k~~  573 (573)
T TIGR00398       560 HKLNK-AEPLFSKIE  573 (573)
T ss_pred             CCCCC-CCCCCCCCC
T ss_conf             00123-335423479