HHsearch alignment for GI: 255764461 and conserved domain: TIGR00440

>TIGR00440 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Glutaminyl-tRNA synthetase (6.1.1.18 from EC) is a class Ic synthetase and shows several similarities with glutamyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. Glutaminyl-tRNA synthetase is a relatively rare synthetase, found in the cytosolic compartment of eukaryotes, in Escherichia coli and a number of other Gram-negative bacteria, and in Deinococcus radiodurans. In contrast, the pathway to Gln-tRNA in mitochondria, Archaea, Gram-positive bacteria, and a number of other lineages is by misacylation with Glu followed by transamidation to correct the aminoacylation to Gln.; GO: 0000166 nucleotide binding, 0004819 glutamine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006425 glutaminyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=96.72  E-value=0.0018  Score=44.78  Aligned_cols=90  Identities=19%  Similarity=0.168  Sum_probs=59.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC-CEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8999988322247897899999999885898-036236437022799999998399989999999999999999808898
Q gi|255764461|r   13 IAYPNAQPHIGHAYEMIIADVLARFHRLDGL-DVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISY   91 (511)
Q Consensus        13 ~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~-~v~~~~g~D~hg~~i~~~A~~~g~~p~e~~~~~~~~~~~~~~~~~i~~   91 (511)
T Consensus         6 PPEPNGYLHIGHaK~I~~NFG~Ak~--y~G~C~LR----FDD-------------TNP~KE~~EY~eSIK~~V~WLGFkw   66 (564)
T TIGR00440         6 PPEPNGYLHIGHAKSICLNFGLAKE--YKGTCNLR----FDD-------------TNPVKEDVEYVESIKRDVEWLGFKW   66 (564)
T ss_pred             CCCCCCCEEHHHHHHHHHHCCCCCC--CCCCEEEE----CCC-------------CCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             8557873001024313442032020--17636442----167-------------8886466017888752222225124


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8674778888999999998887543102211
Q gi|255764461|r   92 DDFIRTTEKRHHDTCRILWKKISDKGDIYKG  122 (511)
Q Consensus        92 D~~~rT~~~~~~~~~~~~~~~l~~~G~iy~~  122 (511)
T Consensus        67 ~g~~-~YsSDYFD~Ly~~A~~LI~~G~AYV~   96 (564)
T TIGR00440        67 EGKI-RYSSDYFDELYRYAVELIKKGLAYVD   96 (564)
T ss_pred             CCCE-EECHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             7731-33304688999999999867960675