HHsearch alignment for GI: 255764461 and conserved domain: TIGR03447

>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase. Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione.
Probab=100.00  E-value=7.7e-38  Score=298.75  Aligned_cols=338  Identities=19%  Similarity=0.234  Sum_probs=225.2

Q ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEC---CCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             881799788899998832224789789999999988589803623---64370227999999983999899999999999
Q gi|255764461|r    4 REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFT---TGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNF   80 (511)
Q Consensus         4 ~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~---~g~D~hg~~i~~~A~~~g~~p~e~~~~~~~~~   80 (511)
T Consensus        36 ~v~mYvCGpTVY--d~~HiGhaR~~v~fD~l~R~L~~~G~~V~~v~NiTDiDD---Kii~~A~~~g~~~~ela~~y~~~f  110 (411)
T TIGR03447        36 EAGMYVCGITPY--DATHLGHAATYLTFDLVNRVWRDAGHRVHYVQNVTDVDD---PLFERAERDGVDWRELGTSQIDLF  110 (411)
T ss_pred             EEEEEECCCCCC--CCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH---HHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             368996588478--888622341689999999999983985589961465425---999999882989999999999999


Q ss_pred             HHHHHHHCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCH----HHHCCCCC-CCCCCHHHHCCCCCCCCCCCCC
Q ss_conf             9999980889-8867477888899999999888754310221100----01011334-3015566721112222222233
Q gi|255764461|r   81 RDMADVLDIS-YDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY----SGWYSLRD-EAYYNDDEVYKGADGQYYNAQH  154 (511)
Q Consensus        81 ~~~~~~~~i~-~D~~~rT~~~~~~~~~~~~~~~l~~~G~iy~~~~----~~~y~~~~-~~~~~~~~v~~~~~~~~~~~~~  154 (511)
T Consensus       111 ~~d~~~Lni~~p~~~praT--e~I~~ii~~I~~Li~kG~AY~~~~~~~gdVYFdv~~~~~y--------G~---Ls~~~~  177 (411)
T TIGR03447       111 REDMEALRVLPPRDYIGAV--ESIDEVIEMVEKLLAAGAAYEVEGPEYPDVYFSIEATEQF--------GY---ESGYDR  177 (411)
T ss_pred             HHHHHHCCCCCCCCCCCCC--CCHHHHHHHHHHHHHCCCEEEECCCCCCCEEEEECCHHHH--------CC---CCCCCH
T ss_conf             9999974999998776743--4799999999999868967982798777579872540110--------65---225799


Q ss_pred             CCE-ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             200-0034544344666444443444333321000676545775410345675323433377765786422214646024
Q gi|255764461|r  155 NPV-QWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID  233 (511)
Q Consensus       155 ~p~-~~~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p~~~~~~~~~wl~~gl~Dw~ISR~~~~WGipiP~~~~~~~YVWfD  233 (511)
T Consensus       178 ~~~~~~~~~~~-----~~~~~~---~Kr~p~DFaLWK~~k--------~gep~W----~SP-WG---~GRPG--------  225 (411)
T TIGR03447       178 ATMLELFAERG-----GDPDRP---GKRDPLDALLWRAAR--------EGEPSW----DSP-FG---PGRPG--------  225 (411)
T ss_pred             HHHHHHHHHCC-----CCCCCC---CCCCHHHHHHHCCCC--------CCCCCC----CCC-CC---CCCCC--------
T ss_conf             99987751114-----774200---246735677714788--------888876----699-88---86883--------


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCC--CCCHHCCCCCCCCHHCCHHHHHHHHH-H-HHCCCCCCCCCCEEECCCCCCHHHCC
Q ss_conf             44322001234676543100024--11000045643210001024776543-3-10123233343033058601000002
Q gi|255764461|r  234 ALTNYLTTTGYLDNPDGSKAKFW--PADLHVIGKDILRFHAIYWPAFLLSA-N-LPLPKKVFSHGFILHKGEKISKSLGN  309 (511)
Q Consensus       234 a~~gY~s~~~~~~~~~~~~~~~w--~~d~~~~G~Dii~Fh~i~~pa~l~~~-~-~~~p~~i~~~g~l~~~G~KMSKS~GN  309 (511)
T Consensus       226 ----------WHIECSaMs~~~LG~~~DIHgGG~DL~FPHHENEiAQsea~~g~~~~a~yWmH~g~l~~~geKMSKSlGN  295 (411)
T TIGR03447       226 ----------WHIECSAIATNRLGAGFDIQGGGSDLIFPHHEFSAAHAEAATGVRRMARHYVHAGMIGLDGEKMSKSLGN  295 (411)
T ss_pred             ----------HHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHECCEEEECCEECCCCCCC
T ss_conf             ----------7799999999875997578788603578885309999998668873766765300231287055666887


Q ss_pred             CCCCCCHHHH-CCCCCCCHHHEEECCCCCCCEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             2111000000-221112111000024787301112221110013321102210213455653123321034555895565
Q gi|255764461|r  310 VIDPIEVIEE-VGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDE  388 (511)
Q Consensus       310 ~I~~~e~l~~-~g~D~lR~~l~~~~~~~~D~~Fs~~~~~~~~n~~L~~~lgN~~~R~~~f~~k~~~g~ip~~~~~~~~D~  388 (511)
T Consensus       296 ~~ti~dl~~~g~~p~~iR~~lL~-~HYRspl~fs~~~L~~A~~~---------l~r~~~a~~~-----~~~-----~---  352 (411)
T TIGR03447       296 LVFVSKLRAAGVDPAAIRLGLLA-GHYRQDRDWTDAVLAEAEAR---------LARWRAALAA-----TDA-----P---  352 (411)
T ss_pred             EEEHHHHHHCCCCHHHHHHHHHC-CCCCCCCCCCHHHHHHHHHH---------HHHHHHHHHC-----CCC-----C---
T ss_conf             25799998649989999999971-44899768898999999999---------9999998726-----677-----5---


Q ss_pred             HHHHHHHHHHHHHHHHH-HHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             66789999999999877-50358999999999999997886
Q gi|255764461|r  389 SILSVCSRVLQEIRENM-QNQLIHRALAQVISLVSEVDRYF  428 (511)
Q Consensus       389 ~ll~~l~~~~~~v~~a~-e~~~~~~Al~~i~~l~~~~N~yi  428 (511)
T Consensus       353 ----~~~~~~~~~~~Al~DDlNTp~Ala~l~~~~~~~n~~~  389 (411)
T TIGR03447       353 ----DATDLIARLRQHLANDLDTPAALAAVDNWAAAALSSG  389 (411)
T ss_pred             ----CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             ----2267999999998601672999999999999998436