HHsearch alignment for GI: 255764461 and conserved domain: cd00395

>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain. These enzymes attach Tyr or Trp, respectively, to the appropriate tRNA. These class I enzymes are homodimers, which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=95.89  E-value=0.028  Score=35.92  Aligned_cols=66  Identities=17%  Similarity=0.280  Sum_probs=41.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99883222478978999999998858980362364370227999999983999899999999999999998088988
Q gi|255764461|r   16 PNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYD   92 (511)
Q Consensus        16 ~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A~~~g~~p~e~~~~~~~~~~~~~~~~~i~~D   92 (511)
T Consensus         9 PTg~lHlG~~v~~~---~~~~~q~~-g~~~~~~iaD~~-a~--~~d---~~~~~~-~i~~~~~~~~~~~~a~g~d~~   74 (274)
T cd00395           9 PTGSLHLGHYVGAI---KLKVLQQA-GHEVIILIADLH-AL--TGD---PSLDPE-EIRKNAREIAKQILALGLDPE   74 (274)
T ss_pred             CCCCCHHHHHHHHH---HHHHHHHC-CCCEEEEEECCC-CC--CCC---CCCCHH-HHHHHHHHHHHHHHHHCCCHH
T ss_conf             88714689999999---99999988-998899990771-14--379---999999-999999999999999779947