HHsearch alignment for GI: 255764461 and conserved domain: cd07958

>cd07958 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases. This domain is found in leucyl tRNA synthetases (LeuRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain. In contrast to other class Ia enzymes, the anticodon is not used as an identity element in LeuRS (with exceptions such as Saccharomyces cerevisiae and some other eukaryotes). No anticodon-binding site can be defined for this family, which includes bacterial and eukaryotic mitochondrial members, as well as LeuRS from the archaeal Halobacteria. LeuRS catalyzes the transfer of leucine to the 3'-end of its tRNA.
Probab=99.41  E-value=2.2e-12  Score=110.61  Aligned_cols=116  Identities=18%  Similarity=0.370  Sum_probs=81.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             12221110013321102210213455653123321034555895565667899999999998775035899999999999
Q gi|255764461|r  342 DKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV  421 (511)
Q Consensus       342 s~~~~~~~~n~~L~~~lgN~~~R~~~f~~k~~~g~ip~~~~~~~~D~~ll~~l~~~~~~v~~a~e~~~~~~Al~~i~~l~  421 (511)
T Consensus         2 se~gIeg~~r--Fl~KlW~l~~~~~~~---~-~~-~~~~~~~~~~d~~i~~~l~~~i~~vt~~~e~~~fN~aia~l~ef~   74 (117)
T cd07958           2 SDSGVEGAYR--FLNRVWRLVTELAEA---L-AA-PAAAAELSEEDKELRRKLHKTIKKVTEDIERLRFNTAIAALMELV   74 (117)
T ss_pred             CCCHHHHHHH--HHHHHHHHHHHHHHH---C-CC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             8006999999--999999999988863---1-34-556544667449999999999999999998522059999999999


Q ss_pred             HHHHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHC
Q ss_conf             99978865418701216999999999999999999999985432248999999984
Q gi|255764461|r  422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL  477 (511)
Q Consensus       422 ~~~N~yi~~~~PW~l~k~d~~~~~~vl~~~l~~l~~l~ilL~Pi~P~~ae~i~~~L  477 (511)
T Consensus        75 N~l~~~~~~~----------~~~~~---~~~~~l~~ll~lL~P~~PHiaEElW~~L  117 (117)
T cd07958          75 NALYKYKKKD----------AQHAA---VLREALETLVLLLAPFAPHIAEELWEEL  117 (117)
T ss_pred             HHHHHHHCCC----------HHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9998846144----------11499---9999999999998842479999998539