HHsearch alignment for GI: 255764461 and conserved domain: cd07961

>cd07961 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases. This domain is found in isoleucyl tRNA synthetases (IleRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon. This family includes bacterial, archaeal, and eukaryotic cytoplasmic members. IleRS catalyzes the transfer of isoleucine to the 3'-end of its tRNA.
Probab=99.66  E-value=1.8e-15  Score=133.40  Aligned_cols=149  Identities=16%  Similarity=0.224  Sum_probs=103.1

Q ss_pred             ECCCCCCCCHHHHHHHHHHHCCHHHHHHH-H-HCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             11222111001332110221021345565-3-123321--0345558955656678999999999987750358999999
Q gi|255764461|r  341 YDKDGLKKRVNADLANGIGNLVSRSVSMI-L-KDYDGM--IPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ  416 (511)
Q Consensus       341 Fs~~~~~~~~n~~L~~~lgN~~~R~~~f~-~-k~~~g~--ip~~~~~~~~D~~ll~~l~~~~~~v~~a~e~~~~~~Al~~  416 (511)
T Consensus         1 F~e~~v~e~~R-~f~nklwN-a~RF~~~~~~~~~~~~~~~~~~~~~~~~~D~WIls~l~~~~~~v~~~~~~y~f~~a~~~   78 (183)
T cd07961           1 FSEKGVREVVR-KVLLPLWN-AYRFFVTYANLDGFDPGKDDDAVASLNVLDRWILSRLNSLIKEVTEEMEAYDLYTAVRA   78 (183)
T ss_pred             CCHHHHHHHHH-HHHHHHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             98889999983-58999998-99999962210179954345560105588999999999999999999980119999999


Q ss_pred             HHHHH-HHHHHHHHHHCCCHHHCCC-HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC----CCCCCHHHHC
Q ss_conf             99999-9997886541870121699-9999999999999999999985432248999999984988----0007955510
Q gi|255764461|r  417 VISLV-SEVDRYFDAQKPWELKKTN-PDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA----DENRCFQSLD  490 (511)
Q Consensus       417 i~~l~-~~~N~yi~~~~PW~l~k~d-~~~~~~vl~~~l~~l~~l~ilL~Pi~P~~ae~i~~~Lg~~----~~~~~~~~~~  490 (511)
T Consensus        79 l~~F~~~l~~wYie~~K~-rl~~~~~~~~~~~a~~~L~~vL~~~l~ll~P~~PFitEeiwq~l~~~~~~~~eSVhl~~~P  157 (183)
T cd07961          79 LLEFIDELTNWYIRRNRK-RFWGEEGDDDKLAAYATLYEVLLTLSRLMAPFTPFITEEIYQNLRRELGDAPESVHLLDWP  157 (183)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCEECCCCC
T ss_conf             999999998999999889-9970566388899999999999999997576402439999998602468988803200689


Q ss_pred             CC
Q ss_conf             12
Q gi|255764461|r  491 QR  492 (511)
Q Consensus       491 ~~  492 (511)
T Consensus       158 ~~  159 (183)
T cd07961         158 EV  159 (183)
T ss_pred             CC
T ss_conf             98