HHsearch alignment for GI: 255764461 and conserved domain: pfam00133

>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included.
Probab=100.00  E-value=0  Score=555.57  Aligned_cols=333  Identities=25%  Similarity=0.390  Sum_probs=280.4

Q ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHC-----CCCH--------
Q ss_conf             888179978889999883222478978999999998858980362364370227999999983-----9998--------
Q gi|255764461|r    3 EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA-----GVTT--------   69 (511)
Q Consensus         3 ~~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~~i~~~A~~~-----g~~p--------   69 (511)
T Consensus        21 ~k~kf~i~~~pPY~nG~lH~GH~~~~t~~D~~aRy~rm~G~~Vl~p~GwD~~GlPiE~~vek~~~~~~~~~~~~~~~~~~  100 (606)
T pfam00133        21 GKPSFTIHDGPPNATGLLHIGHALNKTLKDIVIRYKRMQGFDVLWVPGWDHHGLPTEQKVEKKLGIKGKKDRHKLGREKF  100 (606)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHH
T ss_conf             99958997089897885024266878999999999982899779988456143999999999742115998365799999


Q ss_pred             ----HHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCCHHHHCC
Q ss_conf             ----999999999999999980889886--74778888999999998887543102211000101133430155667211
Q gi|255764461|r   70 ----KVFVDQNSRNFRDMADVLDISYDD--FIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYK  143 (511)
Q Consensus        70 ----~e~~~~~~~~~~~~~~~~~i~~D~--~~rT~~~~~~~~~~~~~~~l~~~G~iy~~~~~~~y~~~~~~~~~~~~v~~  143 (511)
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~lG~~~DW~r~~~T~dp~y~~~~~w~F~~L~~~Gliyr~~~~V~wcp~~~T~La~~Ev~~  180 (606)
T pfam00133       101 REKCREWKMEYADEIRSQFKRLGVSGDWDREYFTLDPGLEAAVWRVFVRLHDKGLIYRGKKPVNWSPALNTALSEAEVEY  180 (606)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCEECCCCCEEE
T ss_conf             99999999999999999999829126458872527812549999999999977981775155012442541224440210


Q ss_pred             CC------------------------------------------------------------------------------
Q ss_conf             12------------------------------------------------------------------------------
Q gi|255764461|r  144 GA------------------------------------------------------------------------------  145 (511)
Q Consensus       144 ~~------------------------------------------------------------------------------  145 (511)
T Consensus       181 ~d~~~~~~~v~f~l~~~~~~~l~i~TTrPeTl~g~~~l~v~p~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  260 (606)
T pfam00133       181 KDVKGPSIHVAFPLADGKGASLVIWTTTPWTLPGNTAVAVNPEFNYVKIRVTGEYYILAEALLKSLYKKKKEDGEILEDF  260 (606)
T ss_pred             CCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCCCEEEEECCCCCEEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             00333035650445789876699994354200365368988887651044386067899999999974033024333133


Q ss_pred             ---------------------------------------------------------------CC---------------
Q ss_conf             ---------------------------------------------------------------22---------------
Q gi|255764461|r  146 ---------------------------------------------------------------DG---------------  147 (511)
Q Consensus       146 ---------------------------------------------------------------~~---------------  147 (511)
T Consensus       261 ~g~~l~G~~~~~P~~~~~ipv~~~~~V~~~~GTG~V~~vPah~~~D~~~~~k~~l~~~~~i~~~g~~~~~~~~~~G~~v~  340 (606)
T pfam00133       261 RGKELIGKKYIHPFVNREIPIIADDYVDMEFGTGAVHIAPAHGEDDYEVGKRHNLEFINPVDDDGTYNEEAPEFQGLKRF  340 (606)
T ss_pred             CCCEECCCEEECCCCCCEEEEEECCCCCCCCCCCCEECCCCCCHHHHHHHHHCCCCCEEEECCCCEECCCCCCCCCCEEE
T ss_conf             45231277897887897578995464156668771333677777999999983998502448988466765111585256


Q ss_pred             --------------------------CCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             --------------------------222223320000345443446664444434443333210006765457754103
Q gi|255764461|r  148 --------------------------QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVK  201 (511)
Q Consensus       148 --------------------------~~~~~~~~p~~~~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p~~~~~~~~~wl~  201 (511)
T Consensus       341 ~a~~~ii~~L~~~g~l~~~~~~~~~~p~~~R~~~~vi~~~~~QWFi~~~~~k~~~~~~~~~-~~-~~P~~~~~~~~~~l~  418 (606)
T pfam00133       341 KARKKIVELLTEKGLLLKIEPIEHSYPHCWRSGTPIIYRATPQWFVRMKNLAEAALKAVEK-VQ-FVPKWGEKRYGNWLE  418 (606)
T ss_pred             ECCHHHHHHHHHCCCEEEEEEECCCCCEECCCCCEEEEEECHHHHHHHHHHHHHHHHHHHH-HH-CCCHHHCCHHHEEEC
T ss_conf             0218999978868986653220101555547894799960278777559999999986443-30-275010120330552


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC------------------------------------------------CCCCCCCCHH
Q ss_conf             4567532343337776578642------------------------------------------------2214646024
Q gi|255764461|r  202 SGLKDLSLSRKTFDWGIKIPDD------------------------------------------------PQYIMYVWID  233 (511)
Q Consensus       202 ~gl~Dw~ISR~~~~WGipiP~~------------------------------------------------~~~~~YVWfD  233 (511)
T Consensus       419 ~-l~DW~iSRQR-~WGtPIPi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~re~DtmDtwfd  496 (606)
T pfam00133       419 N-IQDWCISRQR-WWGHPIPAWYSKDTGEVYVRGSLKELVAGREEEEGIEAWLHRDAKDLLGKGAGTLEQDEDVLDTWFS  496 (606)
T ss_pred             C-CCCCEEEEEC-CCCCCCCEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHCCCCCCCEEECCEEEECEEC
T ss_conf             5-6563575414-6787322698378983167502455554430466753101212465535788751567761202111


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCHHCCHHHHHHHH---HHHHCCCCCCCCCCEE-ECCCCCCHHHCC
Q ss_conf             443220012346765431000241100004564321000102477654---3310123233343033-058601000002
Q gi|255764461|r  234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLS---ANLPLPKKVFSHGFIL-HKGEKISKSLGN  309 (511)
Q Consensus       234 a~~gY~s~~~~~~~~~~~~~~~w~~d~~~~G~Dii~Fh~i~~pa~l~~---~~~~~p~~i~~~g~l~-~~G~KMSKS~GN  309 (511)
T Consensus       497 Sg~~~~~~~~~p~~~~~~f~~~~PvD~~i~G~D~~r~w~~~~--~~~~~~~~~~~Pfk~l~~~G~vld~~G~KMSKSkGN  574 (606)
T pfam00133       497 SGSWPFSTLGYPFTNTPEFKRFFPADMLLEGSDQTRGWFYRM--IVLGTALTGSAPYKNVLVHGLVRDEQGRKMSKSLGN  574 (606)
T ss_pred             CCCCHHHHHCCCHHCHHHHHCCCCCCEEECCHHHHHHHHHHH--HHCCCCCCCCCCCCEEEECCEEECCCCCCCCCCCCC
T ss_conf             775689884785127698953889848977676884899999--970000279976545887661899988788888899


Q ss_pred             CCCCCCHHHHCCCCCCCHHHEEECCCCCCCEEC
Q ss_conf             211100000022111211100002478730111
Q gi|255764461|r  310 VIDPIEVIEEVGVDALRYFLVREIACGKDGFYD  342 (511)
Q Consensus       310 ~I~~~e~l~~~g~D~lR~~l~~~~~~~~D~~Fs  342 (511)
T Consensus       575 vv~p~~~i~~yGaD~~Rl~~~~-a~~~~D~~~S  606 (606)
T pfam00133       575 VIDPLDVIDKYGADALRLWLAS-SDYGRDINFS  606 (606)
T ss_pred             CCCHHHHHHHHCHHHHHHHHHC-CCCHHCCCCC
T ss_conf             7898999987492999999975-9922046559