HHsearch alignment for GI: 255764461 and conserved domain: pfam01921

>pfam01921 tRNA-synt_1f tRNA synthetases class I (K). This family includes only lysyl tRNA synthetases from prokaryotes.
Probab=99.70  E-value=6.7e-17  Score=143.98  Aligned_cols=263  Identities=19%  Similarity=0.219  Sum_probs=140.3

Q ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCH--HHH-------HHHHHCCCC------
Q ss_conf             88179978889999883222478978999999998858980362364370227--999-------999983999------
Q gi|255764461|r    4 REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQ--KIA-------KAAQNAGVT------   68 (511)
Q Consensus         4 ~~~~~vt~~~Py~ng~lHlGH~~~~i~~D~~~R~~r~~G~~v~~~~g~D~hg~--~i~-------~~A~~~g~~------   68 (511)
T Consensus        18 ~~~~v~~tG-~~PSG~~HIGnfrEv~~~~~V~~al~~~g~~~~~i~~~DD~D~lRKVP~nlp~~e~~~~ylg~Pl~~IPd   96 (355)
T pfam01921        18 KGEILVETG-IGPSGLPHIGNFREVLRTDAVRRALRKRGFETRLIYFSDDMDGLRKVPDNVPNSEMLEKYLGKPLTRIPD   96 (355)
T ss_pred             CCCEEEECC-CCCCCCCEEECCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCEECCC
T ss_conf             985899526-6899886421560179999999999974987699998215651013788999989998736975213479


Q ss_pred             ----HHHHHHHHHHHHHHHHHHHCCCCCCCCCCC---CH----------HHHHHHHHHHHHHHHHHCCCCCCH--HHHCC
Q ss_conf             ----899999999999999998088988674778---88----------899999999888754310221100--01011
Q gi|255764461|r   69 ----TKVFVDQNSRNFRDMADVLDISYDDFIRTT---EK----------RHHDTCRILWKKISDKGDIYKGCY--SGWYS  129 (511)
Q Consensus        69 ----p~e~~~~~~~~~~~~~~~~~i~~D~~~rT~---~~----------~~~~~~~~~~~~l~~~G~iy~~~~--~~~y~  129 (511)
T Consensus        97 P~g~~~Sya~h~~~~~~~~L~~~gi~~ef~s~te~Y~sG~~~~~i~~~l~~~~~I~~Il~~~~g~e--~~~~y~Pf~piC  174 (355)
T pfam01921        97 PFGCHESYAEHFNAPFLEFLDRFGIEYEFISATELYKSGLYDEAILIALENRDEIMEILLPYRGEE--RQETYSPFLPIC  174 (355)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCC--CCCCEEEEEEEC
T ss_conf             888745599999999999999839828998678855246559999999985899999999852866--688736898885


Q ss_pred             CCCCCCCCHHHHCC----CCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             33430155667211----12222222233200003454434466644444344433332100067654577541034567
Q gi|255764461|r  130 LRDEAYYNDDEVYK----GADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLK  205 (511)
Q Consensus       130 ~~~~~~~~~~~v~~----~~~~~~~~~~~~p~~~~~~~~~f~~l~~~~~~l~~~~~~~~~~~~p~~~~~~~~~wl~~gl~  205 (511)
T Consensus       175 ~~cGrv~~t-~v~~~d~~~~~v~Y~c~cG~~~~~--------------------------~~~~g~~K---L~W----kv  220 (355)
T pfam01921       175 PKCGRVLTT-PVVEYDAEGGTITYRCECGHEGEV--------------------------DITGGNGK---LQW----KV  220 (355)
T ss_pred             CCCCCEEEE-EEEEEECCCCEEEEECCCCCEEEE--------------------------EECCCCCC---CCC----CC
T ss_conf             888937256-899996789879998699988998--------------------------41157666---787----56


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCHHCCHHH-H--HH-HH
Q ss_conf             53234333777657864222146460244432200123467654310002411000045643210001024-7--76-54
Q gi|255764461|r  206 DLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWP-A--FL-LS  281 (511)
Q Consensus       206 Dw~ISR~~~~WGipiP~~~~~~~YVWfDa~~gY~s~~~~~~~~~~~~~~~w~~d~~~~G~Dii~Fh~i~~p-a--~l-~~  281 (511)
T Consensus       221 DW~m---R--W~-----------------------------~--------lgVdfEp~GKDh~~~GG-S~~~~~~I~~~i  257 (355)
T pfam01921       221 DWAM---R--WA-----------------------------A--------LGVDFEPFGKDHAAPGG-SYDTSSRIAREI  257 (355)
T ss_pred             CCHH---E--EE-----------------------------E--------ECCEEECCCCCCCCCCC-CCHHHHHHHHHH
T ss_conf             6333---0--57-----------------------------8--------56348625743246787-622289999997


Q ss_pred             HHHHCCCCCCCCCCEEE-CCCCCCHHHCCCCCCCCHHHHCCCCCCCHHHEEECCCCCCCEECCCCCCC
Q ss_conf             33101232333430330-58601000002211100000022111211100002478730111222111
Q gi|255764461|r  282 ANLPLPKKVFSHGFILH-KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKK  348 (511)
Q Consensus       282 ~~~~~p~~i~~~g~l~~-~G~KMSKS~GN~I~~~e~l~~~g~D~lR~~l~~~~~~~~D~~Fs~~~~~~  348 (511)
T Consensus       258 ~g~~pP~~~-~YE~~~~kgg~KmSsSkGn~is~~e~L~~~~pE~Lr~l~~~~~P-~~a~~l~fd~ip~  323 (355)
T pfam01921       258 LGGEPPEPF-PYELILLKGGGKMSSSKGNGITIEEWLEYAPPESLRFLMFRVKP-KKAKRLDFDVIPK  323 (355)
T ss_pred             CCCCCCCCC-CEEEEEECCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHCCCCC-CCCEEECCCHHHH
T ss_conf             099999988-65789966997104688987699999986699999999804288-8451207304466