HHsearch alignment for GI: 255764461 and conserved domain: pfam08264

>pfam08264 Anticodon_1 Anticodon-binding domain. This domain is found valyl and leucyl tRNA synthetases. It binds to the anticodon of the tRNA.
Probab=99.42  E-value=3.7e-12  Score=108.98  Aligned_cols=93  Identities=23%  Similarity=0.351  Sum_probs=77.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH--HHHHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             65667899999999998775035899999999999--9997886541870121699999999999999999999998543
Q gi|255764461|r  387 DESILSVCSRVLQEIRENMQNQLIHRALAQVISLV--SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQA  464 (511)
Q Consensus       387 D~~ll~~l~~~~~~v~~a~e~~~~~~Al~~i~~l~--~~~N~yi~~~~PW~l~k~d~~~~~~vl~~~l~~l~~l~ilL~P  464 (511)
T Consensus         1 Dkwil~~l~~~i~~v~~~~e~~~f~~a~~~l~~f~~~~l~~~Yle~~K~~-l~~~~~~~~~~~~~~l~~~l~~~l~ll~P   79 (148)
T pfam08264         1 DRWILSRLNKLIKEVTEAYEKYRFNTAASALYEFFWNDLSDWYLELSKDR-LYGEDPDESKRRATTLYEVLETLLRLLAP   79 (148)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCHH-HCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98999999999999999998079999999999999999989999974052-14788067777999999999999999833


Q ss_pred             CHHHHHHHHHHHCCCC
Q ss_conf             2248999999984988
Q gi|255764461|r  465 FVPKLANKIFDILFVA  480 (511)
Q Consensus       465 i~P~~ae~i~~~Lg~~  480 (511)
T Consensus        80 ~~PfitEeiw~~~~~~   95 (148)
T pfam08264        80 FMPFITEELWQKLGLK   95 (148)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             1088899999867999