BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (511 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254547812|gb|ACT56689.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 511

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK
Sbjct: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY
Sbjct: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY
Sbjct: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT
Sbjct: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
           TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG
Sbjct: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN
Sbjct: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL
Sbjct: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA
Sbjct: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL
Sbjct: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511


>gi|315122341|ref|YP_004062830.1| methionyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495743|gb|ADR52342.1| methionyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 512

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/510 (80%), Positives = 462/510 (90%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K REK YISTAIAYPNA+PHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDE+GQKIAK+
Sbjct: 3   KGREKFYISTAIAYPNAKPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEYGQKIAKS 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           AQNAG+ TK+FVDQNS +FR MADV  ISYDDFIRTTEKRHHDTCRILW+KI DKGDIYK
Sbjct: 63  AQNAGIETKIFVDQNSADFRQMADVFGISYDDFIRTTEKRHHDTCRILWQKILDKGDIYK 122

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           G YSGWYSLRDE Y  DDEVYKG DGQ+YNAQ NPVQWMEEEGYFFRLSAYQDKLL+YY+
Sbjct: 123 GFYSGWYSLRDEMYCGDDEVYKGEDGQHYNAQKNPVQWMEEEGYFFRLSAYQDKLLAYYD 182

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           SHPEFILP+ERRNE++SFVKSGLKDLS+SRKTFDWGIKIP+DPQYIMYVWIDALTNYLT 
Sbjct: 183 SHPEFILPLERRNEIVSFVKSGLKDLSISRKTFDWGIKIPNDPQYIMYVWIDALTNYLTA 242

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
           TG L +P+G KAKFWPADLHVIGKDI+RFHA+YWPAFLLSANLPLPK +FSHGFIL+KGE
Sbjct: 243 TGLLPHPNGEKAKFWPADLHVIGKDIVRFHAVYWPAFLLSANLPLPKTIFSHGFILNKGE 302

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           KISKSLGNVIDP+EVI+E+GVDALRYFL+R+IACGKDGFYD + +K RVNADLANGIGNL
Sbjct: 303 KISKSLGNVIDPMEVIKEIGVDALRYFLIRDIACGKDGFYDINTVKNRVNADLANGIGNL 362

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           VSRS+SMI+K+Y G++P PG F E D+ IL  CS+ +QEIRE+M  QLIHRA+AQVIS+V
Sbjct: 363 VSRSISMIVKNYGGVMPNPGVFVEFDKEILYACSQNIQEIREHMDGQLIHRAVAQVISIV 422

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           SEVDRYF  QKPW+L KT+ DRA+TVLYVTV+V+RQLAILLQ FVP +ANKIFDIL +AD
Sbjct: 423 SEVDRYFATQKPWDLVKTDRDRAATVLYVTVDVVRQLAILLQPFVPGMANKIFDILSIAD 482

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           ENR F  LDQRLK G ++ K F P+FPRFL
Sbjct: 483 ENRSFAHLDQRLKVGLVIDKDFMPLFPRFL 512


>gi|15888821|ref|NP_354502.1| methionyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|25009368|sp|Q8UFA2|SYM_AGRT5 RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|15156579|gb|AAK87287.1| methionyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
          Length = 516

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/513 (58%), Positives = 399/513 (77%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG+DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +    +NS  FR+M  +L+ S DDFIRTTE+RHH+T R +W  ++D GDIY
Sbjct: 61  TARAEGISPEELAQRNSDQFREMGKLLNASNDDFIRTTEERHHETSRNIWNLMADSGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY +DE    ADG  Y  Q  PV+W+EEE YFF+LS YQ+KLL  Y
Sbjct: 121 KDSYAGWYSVRDEAYYAEDETEVRADGVRYGPQGTPVEWVEEESYFFKLSEYQEKLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNE+ISFVKSGLKDLS+SR TFDWGIK+PDDP+++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEIISFVKSGLKDLSISRTTFDWGIKVPDDPKHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+V++HGF+L+KG
Sbjct: 241 ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVYAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP  ++   G+D +RYF +RE++ G+DG Y ++G+  R+NADLANGIGN
Sbjct: 301 EKMSKSLGNVVDPANLVAHFGLDPVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IPTPGAF + D+++L+    +L   RE M  QLIHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGQIPTPGAFNDDDKAMLASADGLLAVCREEMGKQLIHRALAAIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF +Q+PW LKKT+P+R  TVLYVT EV+RQ+ ILLQ F+P+   K+ D++   
Sbjct: 421 VSETDRYFASQEPWALKKTDPERMGTVLYVTAEVVRQIGILLQPFMPQSCEKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL PG  L     P+FPR++
Sbjct: 481 ADGRDFTALGEAGRLAPGTPLEAP-KPVFPRYV 512


>gi|325292849|ref|YP_004278713.1| Methionyl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325060702|gb|ADY64393.1| Methionyl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 516

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/513 (58%), Positives = 398/513 (77%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG+DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +    +NS  FR+M  +L+ S DDFIRTTE+RHH+T R +W  ++D GDIY
Sbjct: 61  TARAEGISPEELAQRNSDQFREMGKLLNASNDDFIRTTEERHHETSRNIWNLMADSGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY +DE    ADG  Y  Q  PV+W+EEE YFF+LS YQDKLL  Y
Sbjct: 121 KDSYAGWYSVRDEAYYGEDETEVRADGVRYGPQGTPVEWVEEESYFFKLSEYQDKLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNE+ISFVKSGLKDLS+SR TFDWGIK+PDDP+++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEIISFVKSGLKDLSISRTTFDWGIKVPDDPKHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+V++HGF+L+KG
Sbjct: 241 ATGYIEDKNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVYAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++G+  R+NADLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IPTPG  T+ D+++L+    +L   RE M  QLIHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGQIPTPGPLTDEDKAMLASADGLLALCREEMGKQLIHRALAAIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF +Q+PW LKKT+P+R  TVLYVT EV+RQ+ ILLQ F+P    K+ D++   
Sbjct: 421 VSETDRYFASQEPWALKKTDPERMGTVLYVTAEVVRQIGILLQPFMPGSCEKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL PG  L     P+FPR++
Sbjct: 481 ADKRDFAALGEAGRLVPGTPLEAP-KPVFPRYV 512


>gi|227822152|ref|YP_002826123.1| methionyl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|227341152|gb|ACP25370.1| methionyl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 516

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/513 (59%), Positives = 396/513 (77%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++    YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG +V F TGTDEHGQK+ +
Sbjct: 1   MRDTSPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGREVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  GV+ +   D+NS  F  MA+VL+ S DDFIRTTEKRHH+  + +W ++ + GD+Y
Sbjct: 61  TARKEGVSPQELADRNSAEFEKMAEVLNASNDDFIRTTEKRHHEASQAIWIRMGEAGDLY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQDKLL +Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRDDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLKHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGI++P+DP ++MYVW+DALTNYLT
Sbjct: 181 EDNPDFIGPSERRNEVISFVKSGLKDLSVSRTTFDWGIRVPNDPAHVMYVWVDALTNYLT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGYL +P G +AKFWPA++HVIGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYLTDPSGPRAKFWPANIHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP  ++E  G+D +RYF +RE++ G+DG Y ++G+  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  TE DE++L+    +++  RE M  QLIHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGQIPACGPLTEEDEAMLAAADALIETTREEMGRQLIHRALAAIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q+PW LKKT+P+R +TVLYVT EV+RQ+AILLQ F+P  A K+ D++ V 
Sbjct: 421 VSETDRYFAGQEPWALKKTDPERMATVLYVTAEVVRQIAILLQPFMPDSAGKLLDLVAVP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            E R F  L +  RL  G  L     P+FPR++
Sbjct: 481 AEKRDFVHLGKSGRLVSGTPLEAP-KPVFPRYI 512


>gi|150396508|ref|YP_001326975.1| methionyl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|150028023|gb|ABR60140.1| methionyl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 516

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/513 (58%), Positives = 395/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++    YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG +V F TGTDEHGQK+ +
Sbjct: 1   MRDTSPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +    +NS  F++MA +L+ S DDFIRTTEKRHH+  + +W ++ + GD+Y
Sbjct: 61  TAKKEGISPQELAARNSAEFQNMARLLNASNDDFIRTTEKRHHEASQAIWTRMGEAGDLY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQD+LL +Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELREDGLRYGPQGTPVEWVEEESYFFRLSAYQDRLLKHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYVT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGYL +P G +AKFWPA++HVIGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYLTDPTGPRAKFWPANIHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP  ++E  G+D +RYF +RE++ G+DG Y ++G+  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  T+ D+++L+    +++  RE M  QLIHRALA  I++
Sbjct: 361 LASRSLSMIVKNCDGQIPVCGPLTDEDKAMLAAADSLIETAREEMGRQLIHRALAATIAI 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q+PW LKKT+P+R +TVLYVT EV+RQ+AILLQ F+P  A K+ D++ V 
Sbjct: 421 VSETDRYFAGQEPWALKKTDPNRMATVLYVTAEVVRQVAILLQPFMPDSAGKLLDLVAVP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F  L +  RL  G  L     P+FPR++
Sbjct: 481 ADRRDFAHLGEGGRLVSGTPLEAP-KPVFPRYV 512


>gi|116252220|ref|YP_768058.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256868|emb|CAK07962.1| putative methionyl-tRNA synthetase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 516

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/513 (57%), Positives = 397/513 (77%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGKDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+NS  F+ MA +L+ S DDFIRTT++RHH+T R +WK ++D GDIY
Sbjct: 61  TARAEGITAQALADRNSGEFQAMATLLNASNDDFIRTTQERHHETSRNIWKLMADSGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQ+KLL++Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYIEDKNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ ++ R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIRTRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  GA  + D ++L+    +    RE+M  Q IHRALA +IS+
Sbjct: 361 LASRSLSMIVKNCDGKIPECGALNDEDRAMLAEVDALHASTREDMGKQQIHRALASIISV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P+R  TVLYVT EV+RQ+AILLQ F+P+ + K+ D++  A
Sbjct: 421 VSETDRYFAGQAPWALKKTDPERMGTVLYVTAEVVRQIAILLQPFMPESSAKLLDLVAAA 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 481 ADKRDFAALGEAGRLVAGTALEAP-TPVFPRYV 512


>gi|15965354|ref|NP_385707.1| methionyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307312729|ref|ZP_07592360.1| methionyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|25009383|sp|Q92PX0|SYM_RHIME RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|15074534|emb|CAC46180.1| Probable methionyl-tRNA synthetase (methionine--tRNA ligase)
           [Sinorhizobium meliloti 1021]
 gi|306899454|gb|EFN30086.1| methionyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 516

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/513 (57%), Positives = 394/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++    YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG +V F TGTDEHGQK+ +
Sbjct: 1   MRDTSPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +    +NS  F++MA +L+ S DDFIRTTE+RHH+  + +W ++ + GD+Y
Sbjct: 61  TAKKEGISPQELAARNSAEFQNMARLLNASNDDFIRTTEQRHHEASQAIWMRMGEAGDLY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQDKLL +Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRGDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLKHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYVT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG L +P G +AKFWPA++HVIGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGCLTDPTGPRAKFWPANIHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP  ++E  G+D +RYF +RE++ G+DG Y ++G+  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG +P  G  T+ D+++L+    ++   RE M  QLIHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGQVPLCGPLTDEDKAMLAAADSLIGTAREEMGKQLIHRALAAIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q+PW LKKT+P R +TVLYVT EV+RQ+AILLQ F+P+ A K+ D++ V 
Sbjct: 421 VSETDRYFAGQEPWALKKTDPSRMATVLYVTAEVVRQVAILLQPFMPESAGKLLDLVAVP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F  L +  RL  G  L     P+FPR++
Sbjct: 481 TDRRDFAHLGEAGRLVSGTPLEAP-KPVFPRYV 512


>gi|307317213|ref|ZP_07596654.1| methionyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306897301|gb|EFN28046.1| methionyl-tRNA synthetase [Sinorhizobium meliloti AK83]
          Length = 516

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/513 (57%), Positives = 394/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++    YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG +V F TGTDEHGQK+ +
Sbjct: 1   MRDTSPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +    +NS  F++MA +L+ S DDFIRTTE+RHH+  + +W ++ + GD+Y
Sbjct: 61  TAKKEGISPQELAARNSAEFQNMARLLNASNDDFIRTTEQRHHEASQAIWMRMGEAGDLY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQDKLL +Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRGDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLKHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYVT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG L +P G +AKFWPA++HVIGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGCLTDPTGPRAKFWPANIHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP  ++E  G+D +RYF +RE++ G+DG Y ++G+  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPFTLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG +P  G  T+ D+++L+    ++   RE M  QLIHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGQVPLCGPLTDEDKAMLAAADSLIGTAREEMGKQLIHRALAAIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q+PW LKKT+P R +TVLYVT EV+RQ+AILLQ F+P+ A K+ D++ V 
Sbjct: 421 VSETDRYFAGQEPWALKKTDPIRMATVLYVTAEVVRQVAILLQPFMPESAGKLLDLVAVP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F  L +  RL  G  L     P+FPR++
Sbjct: 481 TDRRDFAHLGEAGRLVSGTPLEAP-KPVFPRYV 512


>gi|241204713|ref|YP_002975809.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858603|gb|ACS56270.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 516

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/513 (57%), Positives = 395/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGKDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+NS  F+ MA +L+ S DDFIRTT++RHH+T R +WK ++D GDIY
Sbjct: 61  TARAEGITAQALADRNSGEFQAMATLLNASNDDFIRTTQERHHETSRNIWKLMADNGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQ+KLL++Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+PDDP ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPDDPAHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYIEDKNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  GA ++ D+++L+    +    RE M  Q IHRALA +IS+
Sbjct: 361 LASRSLSMIVKNCDGKIPECGALSDEDKAMLAEVDALHASTREEMGKQQIHRALASIISV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P+R  TVLYVT EV+RQ+AILL+ F+P  + K+ D++   
Sbjct: 421 VSETDRYFAGQAPWALKKTDPERMGTVLYVTAEVVRQIAILLRPFMPDSSGKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 481 ADKRDFAALGEAGRLTAGTTLEAP-TPVFPRYV 512


>gi|327193417|gb|EGE60316.1| methionyl-tRNA synthetase protein [Rhizobium etli CNPAF512]
          Length = 519

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/513 (57%), Positives = 391/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 4   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQ 63

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+NS  F  MA +L+ S DDFIRTT++RHH+T R +W  +++ GDIY
Sbjct: 64  TARAEGITAQALADRNSGEFEAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIY 123

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQDKLL++Y
Sbjct: 124 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHY 183

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 184 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYIT 243

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 244 ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG 303

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 304 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN 363

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  ++ DE +L+    +    RE+M  Q IHRALA +I++
Sbjct: 364 LASRSLSMIVKNCDGKIPECGPLSDEDEVMLAQADALHASTREDMGKQQIHRALASIIAV 423

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P R  TVLYVT EV+RQ+AILLQ F+P  + K+ DI+   
Sbjct: 424 VSETDRYFAGQAPWALKKTDPARMGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDIVAAP 483

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 484 ADKRAFAALGEAGRLVAGTPLEAP-TPVFPRYV 515


>gi|190891834|ref|YP_001978376.1| methionyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
 gi|190697113|gb|ACE91198.1| methionyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 516

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/513 (56%), Positives = 394/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+NS  F+ MA +L+ S DDFIRTT++RHH+T R +W  +++ GDIY
Sbjct: 61  TARAEGITAQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQDKLL++Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL++A LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMAAKLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  GA ++ D+++L+    +    RE+M  Q IHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGKIPECGALSDEDKAMLAQADALHASTREDMGKQQIHRALASIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P R  TVLYVT EV+RQ+AILLQ F+P  + K+ D++   
Sbjct: 421 VSETDRYFAGQAPWALKKTDPVRMGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 481 ADKRDFAALGEAGRLVAGTPLEAP-TPVFPRYV 512


>gi|86357775|ref|YP_469667.1| methionyl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|86281877|gb|ABC90940.1| methionyl-tRNA synthetase protein [Rhizobium etli CFN 42]
          Length = 516

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/513 (56%), Positives = 393/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+  +   D+NS  F+ MA +L+ S DDFIRTT++RHH+T R +W  ++D GDIY
Sbjct: 61  TARAEGIAPQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMADNGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQDKLL++Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLP++VF+HGF+L+KG
Sbjct: 241 ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPQRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  T+ D+++L+    +    RE+M  Q IHRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGKIPECGPLTDEDKAMLAQADALHASTREDMGKQQIHRALASIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P R  TVLYVT EV+RQ+AILLQ F+P+ + K+ D++   
Sbjct: 421 VSETDRYFAGQAPWALKKTDPARMGTVLYVTAEVVRQIAILLQPFMPESSGKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 481 ADKRDFAALGEAGRLVAGTPLEAP-TPVFPRYV 512


>gi|209549396|ref|YP_002281313.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535152|gb|ACI55087.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 516

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/513 (56%), Positives = 393/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ++   YI+TAI+YPN +PHIGHAYE+I  D +AR+ RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+NS  F+ MA +L+ S DDFIRTT++RHH+T R +W  +++ GDIY
Sbjct: 61  TARAEGITAQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EE  YFF+LS YQ+KLL++Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEVISFVKSGLKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +G +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYIEDRNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVSHFGLDQVRYFFLREVSFGQDGSYSEEAIGIRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  ++ D+++L+    +    R++M  Q IHRALA +IS+
Sbjct: 361 LASRSLSMIVKNCDGKIPECGVLSDEDKAMLAQADALHASTRDDMGKQQIHRALASIISV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q PW LKKT+P R  TVLYVT EV+RQ+AILLQ F+P  + K+ D++   
Sbjct: 421 VSETDRYFAGQAPWALKKTDPARMGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDLVAAP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL  G  L     P+FPR++
Sbjct: 481 ADKRDFAALGESGRLLAGTPLEAP-TPVFPRYV 512


>gi|222086010|ref|YP_002544542.1| methionyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
 gi|221723458|gb|ACM26614.1| methionyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
          Length = 517

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/513 (56%), Positives = 393/513 (76%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   YI+TAIAYPN +PHIGHAYE+I  D +ARF RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTEKTPFYITTAIAYPNGKPHIGHAYELIATDAMARFQRLDGRDVFFLTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +   D+NS  F+ M  +L+ S DD+IRTTE+RHH+T R +W  ++D GDIY
Sbjct: 61  TARAEGLSPQELADRNSAEFQAMGKLLNSSNDDYIRTTEERHHETSRNIWNLMADAGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W++EE YFF+LS YQD+LL  Y
Sbjct: 121 KDSYAGWYSVRDEAYYQENETELRADGVRYGPQGTPVEWVQEESYFFKLSEYQDRLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P ERRNEVISFVKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T
Sbjct: 181 EENPDFIGPAERRNEVISFVKSGLKDLSISRTTFDWGIKVPNDPAHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TGY+++ +  +AK+WPAD+H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KG
Sbjct: 241 ATGYIEDRNNPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP+ ++   G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGN
Sbjct: 301 EKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L SRS+SMI+K+ DG IP  G  TE D+++L+    +L   RE+M  Q +HRALA +I++
Sbjct: 361 LASRSLSMIVKNCDGKIPECGELTEEDKALLAQADALLASTREDMGKQALHRALASIIAV 420

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           VSE DRYF  Q+PW LKKT+P R +TVLYVT +V+RQ+ ILLQ F+P  + K+ D++ + 
Sbjct: 421 VSESDRYFAGQEPWALKKTDPARMATVLYVTADVVRQIGILLQPFMPDSSTKLLDLIAIP 480

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            + R F +L +  RL PG  L     P+FPR++
Sbjct: 481 SDKRDFAALGEAGRLVPGTPLEAP-KPVFPRYV 512


>gi|222148592|ref|YP_002549549.1| methionyl-tRNA synthetase [Agrobacterium vitis S4]
 gi|221735578|gb|ACM36541.1| methionyl-tRNA synthetase [Agrobacterium vitis S4]
          Length = 525

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/510 (57%), Positives = 382/510 (74%), Gaps = 3/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+TAI+YPN +PHIGHAYE+I  D +ARF RLDG DV F TGTDEHGQK+ + A+
Sbjct: 2   KDTFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGKDVFFLTGTDEHGQKMQQTAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           N G+  +    +NS  FR M  +L+ S DDFIRTTE RHH   + +WK++   GDIYK  
Sbjct: 62  NEGIAPEELAKRNSDEFRAMGKLLNASNDDFIRTTEARHHAASQEIWKRMEKNGDIYKDS 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY +DE    ADG  Y  Q  PV+W+EEE YFFRLSAY+DKLL  YE  
Sbjct: 122 YAGWYSVRDEAYYAEDETEMRADGVRYGPQGTPVEWVEEESYFFRLSAYEDKLLKLYEDQ 181

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P ERRNEV+SFVKSGLKDLS+SR TFDWGIK+P D +++MYVW+DALTNY+T TG
Sbjct: 182 PDFIGPNERRNEVLSFVKSGLKDLSMSRTTFDWGIKVPGDDKHVMYVWVDALTNYITATG 241

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           YL + +G +AK+WPAD H+IGKDI+RFHA+YWPAFLLSA + LPK++F+HGF+L+KGEK+
Sbjct: 242 YLTDENGPRAKYWPADAHIIGKDIIRFHAVYWPAFLLSAGVALPKRIFAHGFVLNKGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNV+DP +++++ G+D +RYFL REI+ G+DG  + + +  R+NADLANGIGNL S
Sbjct: 302 SKSLGNVVDPFDLLQQFGLDNVRYFLCREISFGQDGNCNAELIAPRINADLANGIGNLAS 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ DG +P PG  TE+DE+IL+     +   RE M  Q IH+A+  ++++V+E
Sbjct: 362 RSLSMIAKNLDGKVPQPGPLTEADEAILATADEAIAICREEMSRQQIHKAVGAIMNIVNE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            DRYF AQ PW L+KT+  R  TVLYVT EV+RQ+AIL Q  +P  A K+ D++ +A ++
Sbjct: 422 ADRYFAAQAPWVLRKTDVPRMETVLYVTAEVVRQIAILFQPIMPDSAAKLLDLVAIAPDD 481

Query: 484 RCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           R F  L +  RL PG  L     P+FPR++
Sbjct: 482 RVFAKLGKAGRLTPGTEL-PAVSPVFPRYV 510


>gi|239831997|ref|ZP_04680326.1| methionyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239824264|gb|EEQ95832.1| methionyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 525

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 281/508 (55%), Positives = 373/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G DV F TGTDEHG K+ ++A+
Sbjct: 15  REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGKDVFFLTGTDEHGIKMLQSAR 74

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MADVL+ S DD+IRT+E+RH+   + +WK ++D GDIYKG 
Sbjct: 75  KEGITPRELADRNTAAFRQMADVLNSSNDDYIRTSEERHYKASQAIWKAMADNGDIYKGG 134

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLS+YQD+LL  YE +
Sbjct: 135 YAGWYSVRDEAYYGEEETEVREDGVRYGPQGTPVEWVEEESYFFRLSSYQDRLLDLYEQN 194

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 195 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 254

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  DG K  +WPAD H+IGKDI RFHA+YWPAFL+SA +PLPK+VF+HGF+ ++GEK+
Sbjct: 255 YPDTTDG-KWGYWPADAHIIGKDISRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRGEKM 313

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNVIDP  ++E  G+D LRYFL+RE+  G+DG Y  D +  R NADLAN +GNL  
Sbjct: 314 SKSLGNVIDPFGLVERYGLDQLRYFLMREVPFGQDGSYSHDAIVNRTNADLANDLGNLAQ 373

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PG F+E+D++IL      L   R+ M +Q +H AL  + ++V+E
Sbjct: 374 RSLSMIAKNCEGKVPVPGEFSEADKAILDQAEAALDTARKAMDDQALHLALGGIFAVVAE 433

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EVIR++ I++Q F+P+ A K+ DIL +  + 
Sbjct: 434 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVIRRVGIMVQPFIPQSAEKLLDILAIPADK 493

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 494 RQFSDVTASQLVGGTDLPAPQPVFPRYV 521


>gi|225852500|ref|YP_002732733.1| methionyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|256113542|ref|ZP_05454368.1| methionyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|256264009|ref|ZP_05466541.1| methionyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|265994915|ref|ZP_06107472.1| methionyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|225640865|gb|ACO00779.1| methionyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|262766028|gb|EEZ11817.1| methionyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263094153|gb|EEZ18075.1| methionyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409016|gb|ADZ66081.1| methionyl-tRNA synthetase [Brucella melitensis M28]
 gi|326538726|gb|ADZ86941.1| methionyl-tRNA synthetase [Brucella melitensis M5-90]
          Length = 515

 Score =  619 bits (1597), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 377/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   +++W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|254719073|ref|ZP_05180884.1| methionyl-tRNA synthetase [Brucella sp. 83/13]
 gi|265984063|ref|ZP_06096798.1| methionyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306838355|ref|ZP_07471200.1| methionyl-tRNA synthetase [Brucella sp. NF 2653]
 gi|264662655|gb|EEZ32916.1| methionyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306406495|gb|EFM62729.1| methionyl-tRNA synthetase [Brucella sp. NF 2653]
          Length = 515

 Score =  619 bits (1597), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-KRWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  V ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALEAARKAMDDQALHLALGAVFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPTDK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|17987270|ref|NP_539904.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|17982947|gb|AAL52168.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
          Length = 544

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 32  REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 91

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   +++W+ +   GDIYKG 
Sbjct: 92  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYKGG 151

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 152 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 211

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 212 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 271

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 272 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 330

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 331 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 390

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 391 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 450

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL    + 
Sbjct: 451 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAAPADK 510

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 511 RQFADVLASPLAGGTDLPAPQPVFPRYV 538


>gi|306840483|ref|ZP_07473242.1| methionyl-tRNA synthetase [Brucella sp. BO2]
 gi|306289498|gb|EFM60716.1| methionyl-tRNA synthetase [Brucella sp. BO2]
          Length = 515

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILGQADAALEAARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|153009409|ref|YP_001370624.1| methionyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151561297|gb|ABS14795.1| methionyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 515

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 372/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGKDVFFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MADVL+ S DD+IRT+E+RH+   + +WK ++  GDIYKG 
Sbjct: 63  KEGITPRELADRNTAAFRQMADVLNSSNDDYIRTSEERHYKASQAIWKAMAGNGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE +
Sbjct: 123 YAGWYSVRDEAYYGEEETEVREDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYEKN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  K  +WPAD H+IGKDI RFHA+YWPAFL+SA +PLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTSD-EKWGYWPADAHIIGKDISRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNVIDP  ++E  G+D LRYFL+RE+  G+DG Y  D +  R NADLAN +GNL  
Sbjct: 302 SKSLGNVIDPFGLVERYGLDQLRYFLMREVPFGQDGSYSHDAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PG F+++D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPVPGEFSDADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EVIR++ I++Q F+P+ A K+ DIL +  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVIRRVGIMVQPFIPQSAEKLLDILAIPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFSDVTASQLVGGADLPAPQPVFPRYV 509


>gi|148560370|ref|YP_001258936.1| methionyl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|148371627|gb|ABQ61606.1| methionyl-tRNA synthetase [Brucella ovis ATCC 25840]
          Length = 515

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YTGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|23501876|ref|NP_698003.1| methionyl-tRNA synthetase [Brucella suis 1330]
 gi|225627473|ref|ZP_03785510.1| methionyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|254701747|ref|ZP_05163575.1| methionyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|254706809|ref|ZP_05168637.1| methionyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|254710081|ref|ZP_05171892.1| methionyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|254714082|ref|ZP_05175893.1| methionyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|254716862|ref|ZP_05178673.1| methionyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|256031577|ref|ZP_05445191.1| methionyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|260168708|ref|ZP_05755519.1| methionyl-tRNA synthetase [Brucella sp. F5/99]
 gi|261218663|ref|ZP_05932944.1| methionyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261314276|ref|ZP_05953473.1| methionyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261317630|ref|ZP_05956827.1| methionyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261321839|ref|ZP_05961036.1| methionyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261752300|ref|ZP_05996009.1| methionyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261758184|ref|ZP_06001893.1| methionyl-tRNA synthetase [Brucella sp. F5/99]
 gi|265988665|ref|ZP_06101222.1| methionyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|25009345|sp|P59078|SYM_BRUSU RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|23347815|gb|AAN29918.1| methionyl-tRNA synthetase [Brucella suis 1330]
 gi|225617478|gb|EEH14523.1| methionyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|260923752|gb|EEX90320.1| methionyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261294529|gb|EEX98025.1| methionyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261296853|gb|EEY00350.1| methionyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261303302|gb|EEY06799.1| methionyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738168|gb|EEY26164.1| methionyl-tRNA synthetase [Brucella sp. F5/99]
 gi|261742053|gb|EEY29979.1| methionyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|264660862|gb|EEZ31123.1| methionyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
          Length = 515

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|256044655|ref|ZP_05447559.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564001|ref|ZP_05834487.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|265991079|ref|ZP_06103636.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|25009373|sp|Q8YH17|SYM_BRUME RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|260154017|gb|EEW89109.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|263001863|gb|EEZ14438.1| methionyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 515

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   +++W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL    + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAAPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|256369417|ref|YP_003106925.1| methionine--tRNA ligase [Brucella microti CCM 4915]
 gi|255999577|gb|ACU47976.1| methionine--tRNA ligase [Brucella microti CCM 4915]
          Length = 515

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGTIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|237815420|ref|ZP_04594418.1| methionyl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|237790257|gb|EEP64467.1| methionyl-tRNA synthetase [Brucella abortus str. 2308 A]
          Length = 530

 Score =  618 bits (1593), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 18  REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 77

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 78  KEGITPRDLADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 137

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 138 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 197

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 198 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 257

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 258 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 316

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 317 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 376

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 377 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 436

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 437 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 496

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 497 RQFADVLASPLAGGTDLPAPQPVFPRYV 524


>gi|256061087|ref|ZP_05451242.1| methionyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261325089|ref|ZP_05964286.1| methionyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261301069|gb|EEY04566.1| methionyl-tRNA synthetase [Brucella neotomae 5K33]
          Length = 515

 Score =  618 bits (1593), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPRDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|254704289|ref|ZP_05166117.1| methionyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|261754957|ref|ZP_05998666.1| methionyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|261744710|gb|EEY32636.1| methionyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
          Length = 515

 Score =  617 bits (1592), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNNSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|62289919|ref|YP_221712.1| methionyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82699846|ref|YP_414420.1| methionyl-tRNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189024161|ref|YP_001934929.1| methionine--tRNA ligase [Brucella abortus S19]
 gi|254697361|ref|ZP_05159189.1| methionyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730259|ref|ZP_05188837.1| methionyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260545332|ref|ZP_05821073.1| methionine-tRNA ligase [Brucella abortus NCTC 8038]
 gi|260757954|ref|ZP_05870302.1| methionyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761777|ref|ZP_05874120.1| methionyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|62196051|gb|AAX74351.1| MetG, methionyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82615947|emb|CAJ10970.1| Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class
           Ia:Methionyl-tRNA synthetase, class Ia [Brucella
           melitensis biovar Abortus 2308]
 gi|189019733|gb|ACD72455.1| methionine--tRNA ligase [Brucella abortus S19]
 gi|260096739|gb|EEW80614.1| methionine-tRNA ligase [Brucella abortus NCTC 8038]
 gi|260668272|gb|EEX55212.1| methionyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672209|gb|EEX59030.1| methionyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 515

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRDLADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|306843870|ref|ZP_07476465.1| methionyl-tRNA synthetase [Brucella sp. BO1]
 gi|306275625|gb|EFM57349.1| methionyl-tRNA synthetase [Brucella sp. BO1]
          Length = 515

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 375/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E     DG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVREDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-KRWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALEAARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVQASPLAGGTDLPAPQPVFPRYV 509


>gi|256159715|ref|ZP_05457462.1| methionyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|256254977|ref|ZP_05460513.1| methionyl-tRNA synthetase [Brucella ceti B1/94]
 gi|261222163|ref|ZP_05936444.1| methionyl-tRNA synthetase [Brucella ceti B1/94]
 gi|265998128|ref|ZP_06110685.1| methionyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|260920747|gb|EEX87400.1| methionyl-tRNA synthetase [Brucella ceti B1/94]
 gi|262552596|gb|EEZ08586.1| methionyl-tRNA synthetase [Brucella ceti M490/95/1]
          Length = 515

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GW+S+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWHSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|254693711|ref|ZP_05155539.1| methionyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261213983|ref|ZP_05928264.1| methionyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915590|gb|EEX82451.1| methionyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 515

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 376/508 (74%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ + +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAIDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|163843264|ref|YP_001627668.1| methionyl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|163673987|gb|ABY38098.1| methionyl-tRNA synthetase [Brucella suis ATCC 23445]
          Length = 515

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 375/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P P AF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPSAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|161618949|ref|YP_001592836.1| methionyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|260566464|ref|ZP_05836934.1| methionyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|161335760|gb|ABX62065.1| methionyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|260155982|gb|EEW91062.1| methionyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
          Length = 515

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 375/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRELADRNTSAFRRMAEVLNNSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVK GLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKLGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVFPRYV 509


>gi|114704621|ref|ZP_01437529.1| methionyl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
 gi|114539406|gb|EAU42526.1| methionyl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
          Length = 518

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 285/509 (55%), Positives = 372/509 (73%), Gaps = 3/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E+ Y++TAI+YPN +PHIGHAYE+I  D LARF RLDG DV F TGTDEHG K+ + A+ 
Sbjct: 3   ERYYLTTAISYPNGKPHIGHAYELIATDALARFKRLDGYDVFFLTGTDEHGIKMLQNARA 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T +   D NS  F+ M+  L  S DDFIRT+E RH   C+ +WK++ + GDIYK  Y
Sbjct: 63  QGLTPRELADANSAEFQRMSAALGGSNDDFIRTSEARHKIACQAIWKRMEEAGDIYKDAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           SGWYS+RDEAYY +DE +   DG     Q  PV W+EEE YFFRLS +QD LL  Y  +P
Sbjct: 123 SGWYSVRDEAYYGEDETHISEDGTRIGPQGTPVDWIEEESYFFRLSNFQDPLLKLYAENP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P ERRNEVISFVKSGL+DLS+SR TFDWGI +P D +++MYVW+DALTNYLT TGY
Sbjct: 183 DFIGPNERRNEVISFVKSGLRDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYLTATGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            ++ +G + +FWPADLHVIGKDI RFH +YWPAFL+SA LPL K+V++HGF+ ++GEK+S
Sbjct: 243 PEDGNGGRTEFWPADLHVIGKDITRFHTVYWPAFLMSAGLPLCKRVYAHGFLFNRGEKMS 302

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNVIDP  +++  G+D LRYFL+RE+  G+DG Y  DG+  R N++LAN +GNL  R
Sbjct: 303 KSVGNVIDPFALVDTYGLDRLRYFLLREVPFGQDGNYSHDGIVNRTNSELANDLGNLAQR 362

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SM+ K  +G +P PGAFTE+DE IL     +L + RE ++ Q +H+ LA +I +VS+ 
Sbjct: 363 SLSMVAKHCEGRVPDPGAFTEADELILKAAGDLLAQCREAVEKQQLHQVLAAIIGVVSQA 422

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYF  ++PW L+KT+ DR  TVLYVT EV+R +AILLQ F P+ A K+ DIL V +++R
Sbjct: 423 NRYFAGEEPWALRKTDFDRMQTVLYVTAEVLRTVAILLQPFTPESAGKLLDILGVQEDDR 482

Query: 485 CFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            F  L +  RL PG  L     PIFPRF+
Sbjct: 483 GFDELTKGTRLAPGASLPAP-KPIFPRFV 510


>gi|294852413|ref|ZP_06793086.1| methionyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|294821002|gb|EFG38001.1| methionyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
          Length = 544

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 375/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 32  REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 91

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 92  KEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 151

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y  Q  PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 152 YAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENN 211

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
             FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 212 LGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 271

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 272 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 330

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 331 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 390

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 391 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 450

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 451 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 510

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+FPR++
Sbjct: 511 RQFADVLASPLAGGTDLPAPQPVFPRYV 538


>gi|209885248|ref|YP_002289105.1| methionyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
 gi|209873444|gb|ACI93240.1| methionyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
          Length = 523

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 372/508 (73%), Gaps = 2/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R + YI+TAIAYPN  PHIGHAYE I  D LARF RLDG+DV F TGTDEHG K+ + AQ
Sbjct: 9   RSRYYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGMDVFFLTGTDEHGLKMIQTAQ 68

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T      +N+  F+DM   L+IS+D FIRT+E  HHD+ + +W++++  GDIY   
Sbjct: 69  KEGMTPAELATRNAARFKDMDRRLNISFDRFIRTSEVAHHDSTQEIWRRMAANGDIYLSS 128

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAYQDKLL+ YE H
Sbjct: 129 YAGWYSVRDEAYYAEDETVVGDDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLALYEQH 188

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNEV+SFVK GLKDLS+SR TFDWG+K+PDDP+++MYVW+DALTNY+T   
Sbjct: 189 PEFIGPDVRRNEVVSFVKGGLKDLSISRTTFDWGVKVPDDPEHVMYVWVDALTNYITGIN 248

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D  D +  K+WPAD+HVIGKDI+RFHA+YWPAFL+SA + +PK+V++HGF+ ++GEK+
Sbjct: 249 FPDEAD-ANWKYWPADVHVIGKDIIRFHAVYWPAFLMSAGIAVPKRVYAHGFLFNRGEKM 307

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP E+  + GVD LRYFL+RE+  G+DG Y+ + +  R NADLAN +GNL  
Sbjct: 308 SKSVGNVVDPFELANQYGVDQLRYFLLREVPFGQDGNYNHEAIVARTNADLANDLGNLAQ 367

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K + G++P PGAF+++D++IL+    +L + RE M  Q IH AL ++ ++V+E
Sbjct: 368 RSLSMIGKQHGGIVPEPGAFSDADKAILAQADAMLAQTREAMATQQIHVALNEIWTVVAE 427

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P    K+ D L +A E 
Sbjct: 428 ANRYFAGEAPWSLAKTDPARQKTVLYVTAEVVRQIAILAQPAMPGAMTKMLDSLAIAPEA 487

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F SL  R+KPG  L     P+FPR++
Sbjct: 488 RYFASLATRIKPGTQLPPP-APVFPRYV 514


>gi|300023246|ref|YP_003755857.1| methionyl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525067|gb|ADJ23536.1| methionyl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 520

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 284/510 (55%), Positives = 369/510 (72%), Gaps = 3/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAI+YPN  PHIGHAYE I  DV+ARF RLDG DV F TGTDEHG K+ + A+
Sbjct: 2   REKFYITTAISYPNGVPHIGHAYEAIATDVIARFERLDGKDVFFLTGTDEHGLKMKQTAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT +   D+NS  F +M   L +S DDFIRTTE+RH+D C  LW+++   GDI+K  
Sbjct: 62  REGVTPRELADRNSARFIEMVKTLGLSNDDFIRTTEQRHYDACAELWRRMEKAGDIFKRP 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWYS+RDE YY + E       ++  A   PV+W EEE YFFRLSAYQDKLL++YE++
Sbjct: 122 YGGWYSVRDETYYKESETEVREGQRFATATGTPVEWNEEETYFFRLSAYQDKLLAHYEAN 181

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FILP ERRNEV+SFVK GL+DLS+SR T DWGI +PD P ++MYVWIDAL NY+T TG
Sbjct: 182 PDFILPAERRNEVVSFVKMGLEDLSISRTTLDWGIPVPDAPGHVMYVWIDALNNYVTATG 241

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
            L +P GS+A +WPA++HVIGKDI+RFHA+YWPAFL+SA LPLPK+VFSHGF+L+KGEK+
Sbjct: 242 LLTDPQGSRAHYWPANVHVIGKDIVRFHAVYWPAFLMSAGLPLPKRVFSHGFVLNKGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP ++++  G DALRYF +RE+  G+DG Y  + +  R+NADLAN +GNL  
Sbjct: 302 SKSVGNVVDPFDLVKAYGRDALRYFFLREVMFGQDGNYSAEAIANRINADLANNLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ DG IP PGAF+  D +IL+    + +  R  M  Q I + L  V ++V+E
Sbjct: 362 RSLSMIFKNCDGAIPQPGAFSAEDTAILNATDALYEAARGEMDRQAITKYLDAVWAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF A++PW  KK +P R +T+LYVT E +RQ AIL Q  +P+ A K+ D+L V  E 
Sbjct: 422 ANRYFAAEEPWAKKKADPARMATILYVTAECVRQFAILAQPVMPESAAKLLDLLAVPAEA 481

Query: 484 RCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           R F SL    RLK G  + +    +FPR++
Sbjct: 482 RTFASLGSAGRLKAGTAIPEP-QGVFPRYV 510


>gi|254689226|ref|ZP_05152480.1| methionyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|256257476|ref|ZP_05463012.1| methionyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260754731|ref|ZP_05867079.1| methionyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260883752|ref|ZP_05895366.1| methionyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|297248320|ref|ZP_06932038.1| methionyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
 gi|260674839|gb|EEX61660.1| methionyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260873280|gb|EEX80349.1| methionyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|297175489|gb|EFH34836.1| methionyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 515

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 277/508 (54%), Positives = 374/508 (73%), Gaps = 1/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK YI+TAIAYPN +PHIGHAYE+I  D +ARF RL+G+DV F TGTDEHG K+ ++A+
Sbjct: 3   REKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+N+  FR MA+VL+ S DD+IRT+E+RH+   + +W+ +   GDIYKG 
Sbjct: 63  KEGITPRDLADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    ADG  Y     PV+W+EEE YFFRLSAYQDKLL  YE++
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADGVRYGPPGTPVEWVEEESYFFRLSAYQDKLLDLYENN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI+P ERRNE++SFVKSGLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  +  +WPA+ H+IGKDI RFHA+YWPAFL+SA LPLPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDTTD-ERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP E++E  G+D LRYFL+RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ +G +P PGAF+E+D++IL      L+  R+ M +Q +H AL  + ++V+E
Sbjct: 362 RSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT EV+R++ I++Q F+P+ A K+ DIL V  + 
Sbjct: 422 ANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADK 481

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F  +      G        P+ PR++
Sbjct: 482 RQFADVLASPLAGGTDLPAPQPVLPRYV 509


>gi|218674615|ref|ZP_03524284.1| methionyl-tRNA synthetase [Rhizobium etli GR56]
          Length = 483

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/480 (57%), Positives = 371/480 (77%), Gaps = 3/480 (0%)

Query: 34  LARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDD 93
           +AR+ RLDG DV F TGTDEHGQK+ + A+  G+T +   D+NS  F+ MA +L+ S DD
Sbjct: 1   MARYQRLDGRDVFFLTGTDEHGQKMQQTARAEGITAQELADRNSGEFQAMAKLLNASNDD 60

Query: 94  FIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQ 153
           FIRTT++RHH+T R +WK ++D GDIYK  Y+GWYS+RDEAYY ++E    ADG  Y  Q
Sbjct: 61  FIRTTQERHHETSRNIWKLMADNGDIYKDSYAGWYSVRDEAYYQENETELRADGVRYGPQ 120

Query: 154 HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKT 213
             PV+W+EE  YFF+LS YQ+KLL++YE++P+FI P ERRNEVISFVKSGLKDLS+SR T
Sbjct: 121 GTPVEWVEEASYFFKLSEYQEKLLAHYEANPDFIGPAERRNEVISFVKSGLKDLSVSRTT 180

Query: 214 FDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAI 273
           FDWGIK+P+DP ++MYVW+DALTNY+T TGY+++ DG +AK+WPAD+H+IGKDI+RFHA+
Sbjct: 181 FDWGIKVPNDPSHVMYVWVDALTNYITATGYIEDRDGPRAKYWPADVHIIGKDIIRFHAV 240

Query: 274 YWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREI 333
           YWPAFL+SA LPLPK+VF+HGF+L+KGEK+SKSLGNV+DP+ ++   G+D +RYF +RE+
Sbjct: 241 YWPAFLMSAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREV 300

Query: 334 ACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSV 393
           + G+DG Y ++ +  R+N+DLANGIGNL SRS+SMI+K+ DG IP  GA T+ D+++L+ 
Sbjct: 301 SFGQDGSYSEEAIGTRINSDLANGIGNLASRSLSMIVKNCDGKIPECGALTDEDKAMLAQ 360

Query: 394 CSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVE 453
              +    RE+M  Q IHRALA +I++VSE DRYF  Q PW LKKT+P R  TVLYVT E
Sbjct: 361 ADALHTSTREDMGKQQIHRALASIIAVVSETDRYFAGQAPWALKKTDPARMGTVLYVTAE 420

Query: 454 VIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           V+RQ+AILLQ F+P+ + K+ D++    + R F +L +  RL  G  L     P+FPR++
Sbjct: 421 VVRQIAILLQPFMPESSGKLLDLVAAPADKRDFAALGEAGRLIAGTPLEAP-TPVFPRYV 479


>gi|328543900|ref|YP_004304009.1| Methionyl-tRNA synthetase [Polymorphum gilvum SL003B-26A1]
 gi|326413644|gb|ADZ70707.1| Methionyl-tRNA synthetase [Polymorphum gilvum SL003B-26A1]
          Length = 518

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 285/513 (55%), Positives = 366/513 (71%), Gaps = 4/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  R K YI+TAI+YPN  PHIGHAYE I  D +ARF RLDG DV F TGTDEHGQK+ +
Sbjct: 1   MTARPKYYITTAISYPNGAPHIGHAYEAIATDAMARFQRLDGKDVYFLTGTDEHGQKMLQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G++ +   D+NS  FRDM   L  + DDFIRT+E RHH + + +W++++  GDIY
Sbjct: 61  TAKKEGISVRELADRNSARFRDMVAALGCTNDDFIRTSEPRHHRSSQEIWRRMAANGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  YSGWYS+RDEAYY + E    ADG  Y  Q +PV+W+EEE YFFRLSAYQD+LL++Y
Sbjct: 121 KDSYSGWYSVRDEAYYQEGETELRADGVRYGPQGSPVEWVEEESYFFRLSAYQDRLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P ERRNE++SFVK GLKDLS+SR TFDWGI +P D  ++MYVW+DALTNY+T
Sbjct: 181 EANPDFIGPAERRNEIVSFVKRGLKDLSVSRTTFDWGIPVPGDEAHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D     +WPAD H+IGKDI+RFHA+YWPAFL+SA +PLPK+VF+HGF+ ++G
Sbjct: 241 GVGFPDE-DDPLWSYWPADAHIIGKDIIRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GNVIDP  +IE  G+D  RYF +RE+  G+DG Y  + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNVIDPFNLIEHYGLDQTRYFFLREVPFGQDGNYSHEAIVGRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ DG++P PGA T  DE+IL     +L   R     Q IH+ALA V + 
Sbjct: 360 LAQRSLSMIAKNCDGVLPAPGALTPEDEAILGQADVMLDTCRAAFARQEIHQALACVWAC 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF AQ+PW L+K++P R  TVLYVT EVIRQ+AIL Q   P  A  + D L VA
Sbjct: 420 VAEANRYFAAQEPWALRKSDPARMGTVLYVTAEVIRQIAILAQPVTPNAAALLLDNLGVA 479

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            +NR F  L    RL  G  + K   P FPR++
Sbjct: 480 ADNRVFARLGAAGRLAAGVAIPKPV-PAFPRYV 511


>gi|192291492|ref|YP_001992097.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
 gi|192285241|gb|ACF01622.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 514

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 369/511 (72%), Gaps = 2/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +R   YI+TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAQRNSFYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ  G+T      +N+  FR+M D L +SYD FIRT+E++HH + + +WK++ DKGDIY
Sbjct: 61  TAQKEGLTPHALATRNAGRFREMDDRLGVSYDRFIRTSEEQHHRSVQEVWKRMQDKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAYQDKLL  Y
Sbjct: 121 LDSYSGWYSVRDEAYYAEDETVVGEDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E  P+FI P  RRNEVISFVKSGLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY++
Sbjct: 181 EDQPDFIGPDSRRNEVISFVKSGLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYIS 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D +   +WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ +KG
Sbjct: 241 GVGFPDEND-ANWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GN++DP  + ++ GVD +RYF +RE+  G DG Y+ + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS++M+ K  +G +P  GAF+E+D +IL++   ++ + R  M  Q IH+AL  V ++
Sbjct: 360 LAQRSLTMVAKQCEGKVPEHGAFSENDSAILAMADGMIAQARTAMATQQIHQALNAVWAV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  A K+ DIL +A
Sbjct: 420 VAEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIA 479

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           +  R F +L  R+ PG  L     PIFPR++
Sbjct: 480 EGQRDFAALATRIVPGTPLPAP-APIFPRYV 509


>gi|110633935|ref|YP_674143.1| methionyl-tRNA synthetase [Mesorhizobium sp. BNC1]
 gi|110284919|gb|ABG62978.1| methionyl-tRNA synthetase [Chelativorans sp. BNC1]
          Length = 517

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 276/510 (54%), Positives = 364/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           RE  YI+TAI+YPN +PHIGHAYE+I  D LARF R DG DV+F TGTDEHG K+ + A+
Sbjct: 3   RETFYITTAISYPNGRPHIGHAYELIATDALARFQRCDGKDVMFLTGTDEHGIKMLQTAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T     D+N+  F+ MA +L+ S DDFIRTTE+RH    + +WK ++D+GDIY G 
Sbjct: 63  KEGITAGELADRNAPEFQRMAKLLNASNDDFIRTTEERHRTASQAIWKAMADRGDIYLGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           YSGWYS+RDEAYY +DE   G DG  Y  Q  PV+W+EEE YFFRLSAYQ++LL  YE +
Sbjct: 123 YSGWYSVRDEAYYGEDETRVGEDGVRYGPQGTPVEWVEEESYFFRLSAYQERLLKLYEEN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P ERRNE++SFV+SGL+DLS+SR TFDWG+ +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PDFIGPAERRNEIVSFVRSGLRDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYITALG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  + ++WPAD+H+IGKDI+RFHAIYWPAFL+SA + LPK+VF HGF+ ++GEK+
Sbjct: 243 YPDQ-DAERWRYWPADVHIIGKDIIRFHAIYWPAFLMSAGIALPKRVFGHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP  +IE  G+D +RYF +RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 302 SKSVGNVIDPFTMIEHYGLDQVRYFFLREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+ DG +P  G  + +D +IL      L   R  M  Q IH ALA +  +V+E
Sbjct: 362 RSLSMIAKNCDGKVPARGELSAADRAILDQAEAALATARGAMGRQAIHAALAAIFDVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF AQ+PW L+KT+P R  TVLY T E +R++AIL Q F+P  A K+ D+L V  + 
Sbjct: 422 ANRYFAAQEPWALRKTDPARMETVLYTTAETLRRIAILCQPFIPSSAEKLLDLLSVPQDR 481

Query: 484 RCFQSLDQR--LKPGFMLHKTFDPIFPRFL 511
           R F  + +   L PG  L     P+FPR++
Sbjct: 482 RGFADVGETAMLAPGTPLPAP-QPVFPRYV 510


>gi|260459472|ref|ZP_05807727.1| methionyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259035026|gb|EEW36282.1| methionyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 517

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/510 (54%), Positives = 367/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+TAI+YPN +PHIGHAYE+I  D LARF RLDG  V F TGTDEHG K+ + A+
Sbjct: 3   RDTFYITTAISYPNGKPHIGHAYEVIATDALARFQRLDGKQVFFLTGTDEHGIKMLQTAK 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ +   D+NS +F+ MA  L+ S DDFIRTTE+RH+ + + +WK +   GDIYKG 
Sbjct: 63  REGISARELADRNSADFKRMAAALNASNDDFIRTTEERHYASSQAIWKAMDANGDIYKGG 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY ++E    AD   Y  Q  PV+W+EEE YFFRLSAYQDKL++ YES 
Sbjct: 123 YAGWYSVRDEAYYGEEETEVRADNVRYGPQGTPVEWVEEESYFFRLSAYQDKLIALYESQ 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P ERRNEV+SFVKSGLKDLS+SR TFDWG+ +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PDFIGPAERRNEVMSFVKSGLKDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYITGVG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D  D  K +FWPAD H+IGKDI+RFHA+YWPAFL+SA +PLPK+VF HGF+ ++GEK+
Sbjct: 243 YPDEKD-EKWRFWPADAHIIGKDIVRFHAVYWPAFLMSAGIPLPKRVFGHGFLFNRGEKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP  ++E  G+D +RYF +RE+  G+DG Y  + +  R NADLANG+GNL  
Sbjct: 302 SKSVGNVIDPFTMVEHYGLDQVRYFFLREVPFGQDGSYSHEAIVNRTNADLANGLGNLAQ 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+  G++P  G  TE+D +IL      L   R+ M  Q IH ALA +  +V+E
Sbjct: 362 RSLSMIAKNCGGVVPKRGDLTEADSAILDQAVAALATARKAMAGQGIHLALAAIFDVVAE 421

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            DRYF  Q PW LKKT+P+R  TVL+ T EV+R++ +L Q FVP  A K+ D+L V  + 
Sbjct: 422 ADRYFAGQAPWALKKTDPERMETVLWTTAEVVRRVTVLCQPFVPGSAAKLLDLLAVPADK 481

Query: 484 RCFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
           R F+ +  D  L PG  L    + +FPR++
Sbjct: 482 RDFEHVHADHALVPGTAL-PVPEGVFPRYV 510


>gi|39935844|ref|NP_948120.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
 gi|39649698|emb|CAE28219.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
          Length = 514

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 368/511 (72%), Gaps = 2/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +R   YI+TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAQRNSFYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ  G+T      +N+  FR+M D L +SYD FIRT+E++HH + + +WK++ DKGDIY
Sbjct: 61  TAQKEGLTPHALATRNAGRFREMDDRLGVSYDRFIRTSEEQHHRSVQEVWKRMQDKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAYQDKLL  Y
Sbjct: 121 LDSYSGWYSVRDEAYYAEDETVVGDDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E  P+FI P  RRNEVISFVKSGLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY++
Sbjct: 181 EDQPDFIGPDSRRNEVISFVKSGLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYIS 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D     +WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ +KG
Sbjct: 241 GVGFPDEND-KNWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GN++DP  + ++ GVD +RYF +RE+  G DG Y+ + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS++M+ K  +G +P  GAF+E+D +IL++   ++ + R  M  Q IH+AL  V ++
Sbjct: 360 LAQRSLTMVAKQCEGKVPEHGAFSETDSAILAMADAMITQARTAMATQQIHQALNAVWAV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  A K+ DIL +A
Sbjct: 420 VAEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIA 479

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           +  R F +L  R+ PG  L     PIFPR++
Sbjct: 480 EGQRDFAALATRIVPGTPLPAP-APIFPRYV 509


>gi|316934061|ref|YP_004109043.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris DX-1]
 gi|315601775|gb|ADU44310.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris DX-1]
          Length = 514

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 365/511 (71%), Gaps = 2/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +R   YI+TAI+YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAQRNSFYITTAISYPNGAPHIGHAYEAIATDALARFQRLDGRDVFFLTGTDEHGLKMIQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ  G+T      +N+  FRDM D   ISYD FIRT+E++HH + + +WK++   GDIY
Sbjct: 61  TAQREGMTPAELAARNAGRFRDMDDRFGISYDRFIRTSEEQHHASVQEVWKRMQASGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEAYY +DE   G DG     Q  PV+W+EE+ YFF+LSAYQD+LL  Y
Sbjct: 121 LDSYSGWYSVRDEAYYAEDETVVGEDGVRRGPQGTPVEWVEEKSYFFKLSAYQDRLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E  P+FI P  RRNEVISFVK GLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY+T
Sbjct: 181 EEQPDFIGPDARRNEVISFVKGGLKDLSVSRTTFDWGVKVPSDPEHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D     +WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ +KG
Sbjct: 241 GVGFPDESD-KNWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPIQKRVYAHGFLFNKG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GN++DP  + ++ GVD +RYF +RE+  G DG Y+ + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS++MI K  DG +P  GAF+E+D +IL++   ++ + R  M  Q IH+AL  V ++
Sbjct: 360 LAQRSLTMIAKQCDGKVPEHGAFSENDSAILAMADGMIAQARTAMATQQIHQALNAVWAV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  A K+ DIL +A
Sbjct: 420 VAEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIA 479

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            + R F +L  R+ PG  L     PIFPR++
Sbjct: 480 ADARDFAALPTRIVPGTPLPAP-APIFPRYV 509


>gi|115524873|ref|YP_781784.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
 gi|115518820|gb|ABJ06804.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
          Length = 518

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 275/508 (54%), Positives = 367/508 (72%), Gaps = 2/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  Y++TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHGQK+ + AQ
Sbjct: 8   RDTYYLTTAIAYPNGVPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQ 67

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T      +N+  FR+M D L++SYD FIRTTE++HH + + +W+++   GDIY   
Sbjct: 68  KEGLTPHDLATRNAGRFREMDDKLNVSYDRFIRTTEEQHHRSSQEIWRRMLKNGDIYLDS 127

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY +DE   G D      Q +PV+W+EE+ YFF+LSAYQDKLL  Y   
Sbjct: 128 YAGWYSVRDEAYYAEDETTVGEDKVRRGPQGSPVEWVEEKSYFFKLSAYQDKLLKLYADQ 187

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  R+NEV+SFVK GLKDLS+SR TFDWGIK+PD+  ++MYVW+DALTNY+T  G
Sbjct: 188 PDFIGPDSRKNEVVSFVKGGLKDLSVSRTTFDWGIKVPDEEGHVMYVWVDALTNYITGVG 247

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D  D    ++WPADLHVIGKDI+RFHA+YWPAFL+SA +P+ K+VF+HGF+ ++GEK+
Sbjct: 248 FPDETD-PNWRYWPADLHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVFAHGFLFNRGEKM 306

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP  + E+ GVD LRYFL+RE+  G+DG Y+ + +  R+NADLAN +GNL  
Sbjct: 307 SKSVGNVVDPFNLAEQYGVDQLRYFLLREVQFGQDGSYNHEAIVNRINADLANDLGNLAQ 366

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K Y  ++P PGAF+++D+++L+    +L+  R  M  Q IH+AL  V ++V E
Sbjct: 367 RSLSMIAKQYASIVPEPGAFSDNDKAMLAQADGMLELARTAMATQQIHQALNAVWAVVGE 426

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  + PW L KT+P R  TVLYVT EVIRQ+AIL Q  +P  A K+ DIL +  + 
Sbjct: 427 ANRYFAGEAPWALAKTDPPRQKTVLYVTAEVIRQVAILAQPAIPASAAKLLDILAIPADQ 486

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F +L  R+ PG  +     P+FPR++
Sbjct: 487 RDFAALPNRITPGTQMPAP-APVFPRYV 513


>gi|299133888|ref|ZP_07027082.1| methionyl-tRNA synthetase [Afipia sp. 1NLS2]
 gi|298591724|gb|EFI51925.1| methionyl-tRNA synthetase [Afipia sp. 1NLS2]
          Length = 523

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 267/508 (52%), Positives = 366/508 (72%), Gaps = 2/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R + YI+TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ + AQ
Sbjct: 9   RSRFYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQTAQ 68

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T      +N+  F++M   L+IS+D FIRT+E  HH + + +W++++  GDIY   
Sbjct: 69  KENMTPHELATRNAGRFKEMDQRLNISFDRFIRTSEPAHHASTQEIWRRMAASGDIYLDS 128

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAYQDKLL  YES 
Sbjct: 129 YAGWYSVRDEAYYAEDETVVGEDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLYESQ 188

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE++SFVK GLKDLS+SR TFDWG+K+P+DP+++MYVW+DALTNY+T  G
Sbjct: 189 PDFIGPDSRRNEIVSFVKGGLKDLSISRTTFDWGVKVPNDPEHVMYVWVDALTNYITGIG 248

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D    +  K+WPAD+H+IGKDI+RFHA+YWPAFL++A +P+PK+V++HGF+ ++GEK+
Sbjct: 249 FPDE-KAANWKYWPADVHIIGKDIIRFHAVYWPAFLMAAGIPVPKRVYAHGFLFNRGEKM 307

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP  + ++ GVD +RYF +RE+  G+DG Y+ + +  R NADLAN +GNL  
Sbjct: 308 SKSVGNVVDPFVLADQYGVDQMRYFFLREVPFGQDGNYNHEAIVARTNADLANDLGNLAQ 367

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K + G++P PG F+++D++IL+    +L + R+ M  Q IH AL  + ++V+E
Sbjct: 368 RSLSMIGKQHGGIVPEPGTFSDNDKAILAQADAMLAQARDAMATQQIHVALNAIWAVVAE 427

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P+   K+ DIL V  E 
Sbjct: 428 ANRYFAGEAPWALAKTDPARQKTVLYVTAEVVRQIAILAQPAMPEAMTKMLDILAVPAET 487

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F +L  R+ PG  L     P+FPR++
Sbjct: 488 RDFAALANRIAPGTQLPPP-TPVFPRYV 514


>gi|90417681|ref|ZP_01225593.1| methionyl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337353|gb|EAS51004.1| methionyl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 515

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 272/509 (53%), Positives = 372/509 (73%), Gaps = 5/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E+ Y++TAI+YPN +PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ ++A+ 
Sbjct: 3   ERFYLTTAISYPNGRPHIGHAYEFIATDALARFKRLDGYDVFFLTGTDEHGIKMLQSARE 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G++      +NS  F  MA +L  + DDFIRT+E RH    + +W K++  GD+YK  Y
Sbjct: 63  QGISPAELARRNSAEFEAMAALLGGTNDDFIRTSEDRHVAASQAIWTKMAAAGDVYKDAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           SGWYS+RDEAYY +DE     DG+ Y  Q +PV+W+ EE YFF+LS +QD+LL+ YE +P
Sbjct: 123 SGWYSVRDEAYYGEDETELREDGKRYGPQGSPVEWVAEESYFFKLSEFQDRLLALYEDNP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P ERRNEV+SFV+SGL+DLS+SR TFDWGI +P D +++MYVW+DALTNYLT TG+
Sbjct: 183 DFIGPAERRNEVMSFVRSGLRDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYLTATGF 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            +  +G ++ +WPADLHVIGKDI+RFH +YWPAFL+SA LP+P++V++HGF+ ++GEK+S
Sbjct: 243 PE--EGERSAYWPADLHVIGKDIVRFHTVYWPAFLMSAGLPVPRRVYAHGFLFNRGEKMS 300

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNVIDP  +++  G+D LRYFL+RE+  G+DG Y  + +  R N++LAN +GNL  R
Sbjct: 301 KSVGNVIDPAALVDVYGLDRLRYFLLREVPFGQDGNYSHEAIVNRTNSELANDLGNLAQR 360

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SM+ K     +PTPGAF E+D +IL+  + +L ++R  +  Q +H  LA +I++VSE 
Sbjct: 361 SLSMVGKHCGAKVPTPGAFIEADTAILTAANDLLPKVRTMIDRQELHGVLAAIIAVVSEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYF  Q+PW L+K++P R  TVL+VT E +R++AILLQ FVP+ A K+ DIL V  + R
Sbjct: 421 NRYFAGQEPWALRKSDPARMETVLFVTAEFLRRVAILLQPFVPESAGKLLDILGVGPDAR 480

Query: 485 CFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            F  L  D RL PG  L     PIFPRF+
Sbjct: 481 TFNELTPDVRLAPGADLPAP-QPIFPRFV 508


>gi|86749798|ref|YP_486294.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
 gi|86572826|gb|ABD07383.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
          Length = 514

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 274/511 (53%), Positives = 362/511 (70%), Gaps = 2/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +R   YI+TAI+YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAQRNSFYITTAISYPNGAPHIGHAYEAIATDALARFQRLDGRDVFFLTGTDEHGLKMIQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ  GV T V   +N+  FRDM D   ISYD FIRT+E++HH + + +WK++   GDIY
Sbjct: 61  TAQKEGVETHVLAARNAGRFRDMDDRFGISYDRFIRTSEEQHHRSVQEVWKRMQANGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              Y+GWYS+RDEAYY +DE   G D      Q  PV+W+EE  YFF+LSAYQDKLL  Y
Sbjct: 121 LDSYAGWYSVRDEAYYAEDETVVGEDQIRRGPQGTPVEWVEERSYFFKLSAYQDKLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E  P+FI P  RRNEVISFVK GLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY+T
Sbjct: 181 EDQPDFIGPDSRRNEVISFVKGGLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D +   +WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ +KG
Sbjct: 241 GVGFPDESD-ANWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPIQKRVYAHGFLFNKG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GN++DP  + ++ GVD +RYF +RE+  G DG Y+ + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGADGSYNHEAIVNRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS++M+ K  D  +P  G F+E+D+++L++   ++   R  M  Q IH+AL  V ++
Sbjct: 360 LAQRSLTMVAKQCDAQVPQHGEFSEADKAMLAMADGMIAIARPAMATQQIHQALNAVWAV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF  + PW L KT+P R  TVLYVT EV+RQ+ IL Q  +P  A K+ DIL VA
Sbjct: 420 VAEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQVGILAQPAIPASAAKLLDILGVA 479

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           +  R F +L  R+ PG  L     PIFPR++
Sbjct: 480 EGARDFAALPTRIVPGTPLPAP-APIFPRYV 509


>gi|74420524|gb|ABA04723.1| methionyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 692

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 269/509 (52%), Positives = 363/509 (71%), Gaps = 4/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHGQK+ + AQ 
Sbjct: 181 DTFYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQR 240

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             ++      +N+   R + + LDIS+D FIRT+E  HH + + +WK+++  GDIY   Y
Sbjct: 241 ENISALELATRNAELLRKLDEALDISFDRFIRTSESAHHRSVQDIWKRMAGNGDIYLSNY 300

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           SGWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAY+D+LL+ YES P
Sbjct: 301 SGWYSVRDEAYYAEDETVVGEDNVRRGPQGTPVEWVEEKSYFFKLSAYEDRLLALYESEP 360

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEV+SFVK GLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY+T  G+
Sbjct: 361 DFIGPDSRRNEVVSFVKGGLKDLSISRTTFDWGVKVPGDPEHVMYVWVDALTNYITGVGF 420

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D  D S  +FWPAD+H+IGKDI+RFHA+YWPAFL+SA + LPK+V++HGF+ ++GEK+S
Sbjct: 421 PDE-DESNWRFWPADIHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMS 479

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP  +  + GVD +RYF +RE+  G+DG Y+ + +  R+NADLAN  GNL  R
Sbjct: 480 KSVGNVVDPFSLAAQYGVDQMRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQR 539

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SMI K + G++P PG F+++D++IL+    ++   RE M  Q IH+AL  + S+V+E 
Sbjct: 540 SLSMIAKQHGGVLPEPGDFSDADKAILAQADGMIAIAREAMNTQQIHQALNAIWSVVAEA 599

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P    K+ DIL +  + R
Sbjct: 600 NRYFAGEAPWALAKTDPARQKTVLYVTAEVVRQIAILAQPAMPAACAKLLDILGIPADER 659

Query: 485 CFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            F  L  D R++PG  L     P+FPR++
Sbjct: 660 NFAMLGGDIRIRPGSALPAPV-PVFPRYV 687


>gi|91977188|ref|YP_569847.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
 gi|91683644|gb|ABE39946.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
          Length = 514

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 270/511 (52%), Positives = 366/511 (71%), Gaps = 2/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +R   YI+TAI+YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAQRNSFYITTAISYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ  G+ T V   +N+  FRDM D   +SYD FIRT+E++HH + + +WK++   GDIY
Sbjct: 61  TAQKEGIETHVLAARNAGRFRDMDDRFGVSYDRFIRTSEEQHHRSVQEVWKRMQANGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              Y+GWYS+RDEAYY +DE   G D      Q +PV+W+EE+ YFF+LSAYQD+LL  Y
Sbjct: 121 LDSYAGWYSVRDEAYYAEDETIVGEDNVRRGPQGSPVEWVEEKSYFFKLSAYQDRLLKLY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E  P+FI P  RRNEVISFVK GLKDLS+SR TFDWG+++P DP+++MYVW+DALTNY+T
Sbjct: 181 EDQPDFIGPDSRRNEVISFVKGGLKDLSVSRTTFDWGVEVPGDPEHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+ D  D +  ++WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ +KG
Sbjct: 241 GVGFPDETD-ANWRYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GN++DP  + ++ GVD +RYF +RE+  G DG Y+ + +  R+NADLAN +GN
Sbjct: 300 EKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS++MI K  +  +P  G F+++D+++L++   ++   R  M  Q IH+AL  V ++
Sbjct: 360 LAQRSLTMIAKQCEAKVPEHGDFSDADKAMLAMADGMIAPARTAMATQQIHQALNAVWAV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF  + PW L KT+P R  TVLYVT EV+RQ+ IL Q  +P  A K+ DIL VA
Sbjct: 420 VAEANRYFAGEAPWALAKTDPPRQKTVLYVTAEVLRQIGILAQPAIPGSATKLLDILGVA 479

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            + R F +L  R+KPG  L     PIFPR++
Sbjct: 480 ADARDFAALATRIKPGTPLPAP-APIFPRYV 509


>gi|254469852|ref|ZP_05083257.1| methionyl-tRNA synthetase [Pseudovibrio sp. JE062]
 gi|211961687|gb|EEA96882.1| methionyl-tRNA synthetase [Pseudovibrio sp. JE062]
          Length = 517

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/513 (54%), Positives = 372/513 (72%), Gaps = 4/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   YI+TAI+YPN +PHIGHAYE I  DVLARF RLDG +V F TGTD HGQK+ +
Sbjct: 1   MTEKSPFYITTAISYPNGEPHIGHAYEAIATDVLARFQRLDGREVHFLTGTDVHGQKMLQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A   G++     D+NS+ FR+M ++L  S DDFI+T E+RH+ +C+ +W+K++D GDIY
Sbjct: 61  TAVKEGMSPSDLADKNSKLFREMVEMLGCSNDDFIQTNEERHYKSCQAIWQKMADAGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY + E     DG  Y  Q  PV+W+EEE YFFRLSAY+DKL+  Y
Sbjct: 121 KDSYAGWYSVRDEAYYQEGETEVREDGVRYGPQGTPVEWVEEESYFFRLSAYEDKLIELY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P  RRNEV+SFVK GLKDLS+SR TFDWGI +P D +++MYVW+DALTNY+T
Sbjct: 181 EKNPDFIGPNARRNEVMSFVKGGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D  DG  AKFWPA+ H+IGKDI+RFHA+YWPAFL+SA +PLP++VF+HGF+ + G
Sbjct: 241 ALGYPDM-DGDMAKFWPANAHIIGKDIIRFHAVYWPAFLMSAGVPLPERVFAHGFLFNSG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNVI P +++E  G+D +RYF +RE+  G+DG Y+ + +  R+NADLAN IGN
Sbjct: 300 EKMSKSLGNVIAPRDLVETYGLDQIRYFFLREVPFGQDGNYNHEAMVNRINADLANDIGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ +G +P PG F+  D++IL     +L++ R  M  Q IH ALA + S 
Sbjct: 360 LAQRSLSMIFKNCEGKLPVPGEFSADDKAILQQADEMLEKCRGFMAKQEIHHALACIWST 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +Q+PW LKKT P+R  TVLY T E+IRQ+ IL Q  +P  A K+ D+L ++
Sbjct: 420 VGEANRYFASQEPWALKKTEPERMGTVLYTTAEIIRQVGILAQPVMPTSAGKLLDLLVLS 479

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           D+ R F  L +  RL+ G  L K    +FPR++
Sbjct: 480 DDERSFAELGEAGRLQGGRELPKP-QGVFPRYV 511


>gi|85715531|ref|ZP_01046512.1| methionine--tRNA ligase [Nitrobacter sp. Nb-311A]
 gi|85697726|gb|EAQ35602.1| methionine--tRNA ligase [Nitrobacter sp. Nb-311A]
          Length = 695

 Score =  588 bits (1517), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 268/507 (52%), Positives = 362/507 (71%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHGQK+ + AQ   
Sbjct: 186 FYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQREN 245

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++      +N+   R + + L IS+D FIRT+E  HH + + +WK++++ GDIY   YSG
Sbjct: 246 ISALELATRNAELLRKLDETLHISFDRFIRTSESAHHRSVQEIWKRMAENGDIYLSNYSG 305

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+L++YQD+LL+ YES P+F
Sbjct: 306 WYSVRDEAYYAEDETIVGEDNVRRGPQGTPVEWVEEKSYFFKLASYQDRLLALYESEPDF 365

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFVK GLKDLS+SR  FDWGIK+PDDP+++MYVW+DALTNY+T  G+  
Sbjct: 366 IGPDSRRNEVVSFVKGGLKDLSISRTNFDWGIKVPDDPEHVMYVWVDALTNYITGVGF-P 424

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           N D S  +FWPA +H+IGKDI+RFHA+YWPAFL+SA + LPK+V++HGF+ ++GEK+SKS
Sbjct: 425 NEDESNWRFWPAGVHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMSKS 484

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  +  + GVD +RYF +RE+  G DG Y+ + +  R+NADLAN  GNL  RS+
Sbjct: 485 VGNVVDPFSLAAQYGVDQMRYFFLREVPFGHDGSYNHEAIVARINADLANDFGNLAQRSL 544

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K + G++P PG F++SD++IL+    ++   RE M+ Q IH+AL  + ++V+E +R
Sbjct: 545 SMIAKQHGGVLPEPGDFSDSDKAILAQADGMIAVAREAMKTQQIHQALNAIWAVVAEANR 604

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P+   K+ DIL +  + R F
Sbjct: 605 YFAGEAPWVLAKTDPARQRTVLYVTAEVVRQIAILAQPAMPEACAKMLDILGIPTDERNF 664

Query: 487 QSLDQ--RLKPGFMLHKTFDPIFPRFL 511
             L    R+KPG ML     P+FPR++
Sbjct: 665 AMLGGHVRIKPGTMLPPPV-PVFPRYV 690


>gi|162139845|ref|YP_318075.2| methionyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 544

 Score =  588 bits (1515), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 269/509 (52%), Positives = 363/509 (71%), Gaps = 4/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI YPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHGQK+ + AQ 
Sbjct: 33  DTFYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQR 92

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             ++      +N+   R + + LDIS+D FIRT+E  HH + + +WK+++  GDIY   Y
Sbjct: 93  ENISALELATRNAELLRKLDEALDISFDRFIRTSESAHHRSVQDIWKRMAGNGDIYLSNY 152

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           SGWYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAY+D+LL+ YES P
Sbjct: 153 SGWYSVRDEAYYAEDETVVGEDNVRRGPQGTPVEWVEEKSYFFKLSAYEDRLLALYESEP 212

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEV+SFVK GLKDLS+SR TFDWG+K+P DP+++MYVW+DALTNY+T  G+
Sbjct: 213 DFIGPDSRRNEVVSFVKGGLKDLSISRTTFDWGVKVPGDPEHVMYVWVDALTNYITGVGF 272

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D  D S  +FWPAD+H+IGKDI+RFHA+YWPAFL+SA + LPK+V++HGF+ ++GEK+S
Sbjct: 273 PDE-DESNWRFWPADIHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMS 331

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP  +  + GVD +RYF +RE+  G+DG Y+ + +  R+NADLAN  GNL  R
Sbjct: 332 KSVGNVVDPFSLAAQYGVDQMRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQR 391

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SMI K + G++P PG F+++D++IL+    ++   RE M  Q IH+AL  + S+V+E 
Sbjct: 392 SLSMIAKQHGGVLPEPGDFSDADKAILAQADGMIAIAREAMNTQQIHQALNAIWSVVAEA 451

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P    K+ DIL +  + R
Sbjct: 452 NRYFAGEAPWALAKTDPARQKTVLYVTAEVVRQIAILAQPAMPAACAKLLDILGIPADER 511

Query: 485 CFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            F  L  D R++PG  L     P+FPR++
Sbjct: 512 NFAMLGGDIRIRPGSALPAPV-PVFPRYV 539


>gi|154248247|ref|YP_001419205.1| methionyl-tRNA synthetase [Xanthobacter autotrophicus Py2]
 gi|154162332|gb|ABS69548.1| methionyl-tRNA synthetase [Xanthobacter autotrophicus Py2]
          Length = 550

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 272/513 (53%), Positives = 363/513 (70%), Gaps = 3/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +   YI+TAIAYPN  PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+ +
Sbjct: 33  MSAKPPFYITTAIAYPNGVPHMGHAYEAIATDCIARFKRLDGYDVRFLTGTDEHGIKMLQ 92

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ AGVT +  + +N   F  M +  ++S DDFIRTT++RHH + + +W K++  GDIY
Sbjct: 93  TAQKAGVTPRELLARNVPRFEAMVEAFNLSIDDFIRTTQERHHASSQAIWAKMAANGDIY 152

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y+GWYS+RDEAYY +DE      G     Q  PV+W+EEE YFFRLSAYQD+LL+YY
Sbjct: 153 KSTYAGWYSVRDEAYYAEDETQLNEQGIRLGPQGTPVEWVEEESYFFRLSAYQDRLLAYY 212

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
             +P FI+P  RRNEV+SFV  GL DLS+SR TFDWGI +P D ++IMYVW+DALTNY+T
Sbjct: 213 AENPGFIMPEARRNEVVSFVSGGLTDLSISRTTFDWGIPVPGDDKHIMYVWVDALTNYIT 272

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D       +FWPA+LHVIGKDI+RFHA+YWPAFL SA L  PK+VF HGF+ ++G
Sbjct: 273 ALGYPDTEAELFKRFWPANLHVIGKDIIRFHAVYWPAFLWSAGLEAPKRVFGHGFLFNRG 332

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GNVIDP ++    GVDA+RYF +RE++ G+DG Y  + +  R+NADLAN +GN
Sbjct: 333 EKMSKSVGNVIDPFDLAATYGVDAIRYFFLREVSFGQDGSYSHEAIVARMNADLANDLGN 392

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ DG++P PG  +  DE+IL++   +L++ RE M+ Q IH  LA V ++
Sbjct: 393 LAQRSLSMIAKNLDGVVPQPGPLSPEDEAILALADGMLEKSREAMEGQAIHHYLAAVWNV 452

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF AQ PW L+KT+P R +TVL+VT E+IR++ IL+Q  +P+ A ++ D++ V 
Sbjct: 453 VAEANRYFAAQAPWALRKTDPARMATVLWVTAELIREVGILVQPVMPESAARLLDLVVVP 512

Query: 481 DENRCFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            + R F  L    RL  G +L      +FPR++
Sbjct: 513 ADERGFDRLGAGHRLPAGRVLPAPVG-VFPRYV 544


>gi|146340771|ref|YP_001205819.1| methionyl-tRNA synthetase [Bradyrhizobium sp. ORS278]
 gi|146193577|emb|CAL77594.1| Methionyl-tRNA synthetase (EC 6.1.1.10) [Bradyrhizobium sp. ORS278]
          Length = 705

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 266/507 (52%), Positives = 363/507 (71%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAIAYPN  PHIGHAYE I  D +ARF RLDG DV F TGTDEHG K+ + AQN G
Sbjct: 196 FYVTTAIAYPNGSPHIGHAYEAIATDAIARFARLDGKDVFFLTGTDEHGLKMVQTAQNEG 255

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T      +N+  FR+M + L++S+D FIRTTE  HH + + +W ++ + GDIY   YSG
Sbjct: 256 LTPSELAARNAGRFREMDERLNVSFDRFIRTTEPAHHKSVQAIWTRMLENGDIYADTYSG 315

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY ++E   G D      Q  PV+W+EE+ YFFRLSAYQDKLL+ YE+ P+F
Sbjct: 316 WYSVRDEAYYAEEETVVGEDNVRRGPQGTPVEWVEEKSYFFRLSAYQDKLLALYENQPDF 375

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE+ SFV+ GLKDLS+SR TFDWG+++P D +++MYVW+DALTNY+T  G+ D
Sbjct: 376 IGPDARRNEITSFVRGGLKDLSISRTTFDWGVRVPHDDEHVMYVWVDALTNYITGVGFPD 435

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D +  KFWPAD+HVIGKDI+RFHA+YWPAFL+SA +P+PK+V++HGF+ ++GEK+SKS
Sbjct: 436 END-ANWKFWPADVHVIGKDIIRFHAVYWPAFLMSAGVPVPKRVYAHGFLFNRGEKMSKS 494

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  + ++ GVD LRYF +RE+  G+DG Y+ + +  R+NADLAN +GNL  RS+
Sbjct: 495 VGNVVDPFNLADQYGVDQLRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSL 554

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K + G++P PG F+ +D++IL+    ++   R+ M  Q IH+ L  V S+V+E +R
Sbjct: 555 SMITKQFGGVLPEPGEFSANDQAILAEADAMIGAARKAMATQQIHQWLNAVWSVVAEANR 614

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYVT EVIRQ+AIL Q  +P  + K+ D L + ++ R F
Sbjct: 615 YFAGEAPWALAKTDPKRQHTVLYVTAEVIRQVAILTQPVMPAASAKLLDSLGIPEDERSF 674

Query: 487 QSL--DQRLKPGFMLHKTFDPIFPRFL 511
             L  + R+ PG  L      +FPR++
Sbjct: 675 ARLGGEVRIAPGTQLPAP-QAVFPRYI 700


>gi|254563518|ref|YP_003070613.1| methionyl-tRNA synthetase [Methylobacterium extorquens DM4]
 gi|254270796|emb|CAX26801.1| methionyl-tRNA synthetase [Methylobacterium extorquens DM4]
          Length = 522

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/512 (54%), Positives = 364/512 (71%), Gaps = 5/512 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K  E   I+TAI+YPN  PHIGHAYE+I  D +ARFHRLDG DVLFTTGTDEHG KI + 
Sbjct: 6   KANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGRDVLFTTGTDEHGLKIQQT 65

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AGVT + FVD  +  F+ +AD LD SYD FIRTTE  H+   + LW+++   GDIY 
Sbjct: 66  ASRAGVTPRAFVDDMAGRFKAVADRLDCSYDRFIRTTEADHYAAAQELWRRMEANGDIYL 125

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y+GWYS+RDEAYY++ E   G DG   + + + PV+WMEEE Y FRLS YQ+ LL  Y
Sbjct: 126 AKYAGWYSVRDEAYYDEAETALGPDGNRRSIKTDTPVEWMEEENYLFRLSKYQEPLLKLY 185

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
              P+F+ P  R NEV SFV+SGLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT
Sbjct: 186 AEQPDFLGPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDALTNYLT 245

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D      A+FWPA LH+IGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF L +G
Sbjct: 246 VTGFPDA-KAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFFLSRG 304

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP++++   GVD +RYFL+RE   G DG YD D +  R+NADLAN +GN
Sbjct: 305 EKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGSDGNYDHDAIINRINADLANDLGN 364

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ +G +P PGAFTE+DE +L+    + ++ R  MQN  +H  LA++ ++
Sbjct: 365 LAQRSLSMIAKNCEGTVPEPGAFTEADERLLAAAGALPEKARGLMQNLALHAILAEIWAV 424

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +++PW+L+K++P R +TVLYVTVE +R++ +++Q FVP     + D+L V 
Sbjct: 425 VGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDLLAVP 484

Query: 481 DENR--CFQSLDQRLKPGFMLHKTFDPIFPRF 510
              R   F   + RL+ G  L     PIFPRF
Sbjct: 485 VNARSFAFTGAEHRLQGGTALPAP-APIFPRF 515


>gi|163853584|ref|YP_001641627.1| methionyl-tRNA synthetase [Methylobacterium extorquens PA1]
 gi|163665189|gb|ABY32556.1| methionyl-tRNA synthetase [Methylobacterium extorquens PA1]
          Length = 522

 Score =  585 bits (1508), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 364/512 (71%), Gaps = 5/512 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K  E   I+TAI+YPN  PHIGHAYE+I  D +ARFHRLDG DVLFTTGTDEHG KI + 
Sbjct: 6   KANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGRDVLFTTGTDEHGLKIQQT 65

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AGVT + FVD  +  F+ +AD LD SYD FIRTTE  H+   + LW+++   GDIY 
Sbjct: 66  ASRAGVTPRAFVDDMAGRFKAVADRLDCSYDRFIRTTEADHYAAAQELWRRMEANGDIYL 125

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y+GWYS+RDEAYY++ E   G DG   + + + PV+WMEEE Y FRLS YQ+ LL  Y
Sbjct: 126 AKYAGWYSVRDEAYYDEAETALGPDGNRRSIKTDTPVEWMEEENYLFRLSKYQEPLLKLY 185

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
              P+F+ P  R NEV SFV+SGLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT
Sbjct: 186 AEQPDFLGPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDALTNYLT 245

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D      A+FWPA LH+IGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF L +G
Sbjct: 246 VTGFPDA-QAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFFLSRG 304

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP++++   GVD +RYFL+RE   G DG YD + +  R+NADLAN +GN
Sbjct: 305 EKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGSDGNYDHEAIINRINADLANDLGN 364

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ +G +P PGAFTE+DE +L+    + ++ R  MQN  +H  LA++ ++
Sbjct: 365 LAQRSLSMIAKNCEGTVPEPGAFTEADERLLAAAGALPEKARGLMQNLALHAILAEIWAV 424

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +++PW+L+K++P R +TVLYVTVE +R++ +++Q FVP     + D+L V 
Sbjct: 425 VGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDLLAVP 484

Query: 481 DENR--CFQSLDQRLKPGFMLHKTFDPIFPRF 510
              R   F   + RL+ G  L     PIFPRF
Sbjct: 485 VNARSFAFTGAEHRLQGGTALPAP-APIFPRF 515


>gi|92117538|ref|YP_577267.1| methionyl-tRNA synthetase [Nitrobacter hamburgensis X14]
 gi|91800432|gb|ABE62807.1| methionyl-tRNA synthetase [Nitrobacter hamburgensis X14]
          Length = 659

 Score =  585 bits (1508), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 267/507 (52%), Positives = 359/507 (70%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI YPN  PHIGHAYE I  DVLARF RLDG DV F TGTDEHGQK+ + AQ   
Sbjct: 150 FYITTAIVYPNGAPHIGHAYEAIATDVLARFQRLDGKDVFFLTGTDEHGQKMVQTAQKEN 209

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++      +N+   R + + L+IS++ FIRT+E  HH + + +WK+++  GDIY   Y+G
Sbjct: 210 ISALELATRNAELLRKLDETLNISFNRFIRTSEPAHHHSVQEIWKRMAANGDIYLSSYAG 269

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFF+LSAYQD+LL+ YES P+F
Sbjct: 270 WYSVRDEAYYAEDETVVGEDNVRRGPQGTPVEWVEEKSYFFKLSAYQDRLLALYESQPDF 329

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEVISFVK GLKDLS+SR TFDWG+K+PDDP+++MYVW+DALTNY+T  G+ D
Sbjct: 330 IGPDSRRNEVISFVKGGLKDLSISRTTFDWGVKVPDDPEHVMYVWVDALTNYITGVGFPD 389

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    ++WPADLH+IGKDI+RFHA+YWPAFL+SA +PL K+V++HGF+ ++GEK+SKS
Sbjct: 390 END-KDWRYWPADLHIIGKDIIRFHAVYWPAFLMSAGIPLQKRVYAHGFLFNRGEKMSKS 448

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  +  + GVD +RYF +RE+  G+DG Y+ + +  R+NADLAN  GNL  RS+
Sbjct: 449 VGNVVDPFNLAAQYGVDQVRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQRSL 508

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K +DG +P PG F+++D++IL+    ++   RE M  Q IH+AL  V ++V+E +R
Sbjct: 509 SMIAKQHDGALPEPGDFSDNDKAILAQADGMIAVAREAMNTQQIHQALNAVWAVVAEANR 568

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYV  EV+RQ+AIL Q  +P     + D+L +    R F
Sbjct: 569 YFAGEAPWVLAKTDPARQKTVLYVAAEVVRQIAILAQPAMPASCATMLDLLGIPASERNF 628

Query: 487 QSLDQ--RLKPGFMLHKTFDPIFPRFL 511
             L    R+KPG  L     P+FPR++
Sbjct: 629 AMLGGHVRIKPGTTLPPPV-PVFPRYV 654


>gi|158423799|ref|YP_001525091.1| methionyl-tRNA synthetase [Azorhizobium caulinodans ORS 571]
 gi|158330688|dbj|BAF88173.1| methionyl-tRNA synthetase [Azorhizobium caulinodans ORS 571]
          Length = 526

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 361/512 (70%), Gaps = 1/512 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +   YI+TAIAYPN  PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+ +
Sbjct: 7   MSSKRPFYITTAIAYPNGVPHMGHAYEAIATDCIARFKRLDGYDVRFLTGTDEHGIKMLQ 66

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ AG+T +  +D+N   F+ M    ++S DDFIRTTE+RH  + + +W++++ KGDIY
Sbjct: 67  TAQKAGLTPRELLDRNVPAFKAMGPAFNLSNDDFIRTTEERHIKSSQAIWERMAAKGDIY 126

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  YSGWYS+RDEAYY +DE            Q  PV+W+EEE YFFRLSAYQ KLL +Y
Sbjct: 127 KSTYSGWYSVRDEAYYAEDETTVNEQNVRLGPQGTPVEWVEEESYFFRLSAYQQKLLDFY 186

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
            ++P FI+P  RRNEV+SFV  GL+DLS+SR TFDWGI +P DP +IMYVW+DALTNY+T
Sbjct: 187 AANPGFIMPEARRNEVVSFVSGGLQDLSISRTTFDWGIPVPGDPAHIMYVWVDALTNYIT 246

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D       KFWPADLHVIGKDI+RFHA+YWPAFL SA L  PK+VF HGF+ ++G
Sbjct: 247 ALGYPDTDAELFRKFWPADLHVIGKDIIRFHAVYWPAFLWSAGLEPPKRVFGHGFLFNRG 306

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GNV+DP  ++E  GVDA RYF +RE++ G+DG Y  + +  R+NADLAN +GN
Sbjct: 307 EKMSKSVGNVVDPFGLVETYGVDATRYFFLREVSFGQDGSYSHEAIVNRMNADLANDLGN 366

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ DG++P PG  +  DE+IL++   +L++ RE M+ Q IH+ LA V ++
Sbjct: 367 LAQRSLSMISKNLDGVVPEPGPLSPEDEAILALADGMLEKAREAMEVQAIHQYLAAVWAV 426

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V+E +RYF AQ PW L+KT+P R  TVL+ T EVIRQ+AIL Q  +P+ A K+ D+L V 
Sbjct: 427 VAEANRYFAAQAPWALRKTDPKRMETVLWTTAEVIRQVAILAQPVMPESAGKMLDLLVVP 486

Query: 481 DENRCFQSLDQRLK-PGFMLHKTFDPIFPRFL 511
            E R F  L    + PG         +FPR++
Sbjct: 487 AEQRGFDVLGGTFRLPGGTAIPAPTGVFPRYV 518


>gi|148255487|ref|YP_001240072.1| methionyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
 gi|146407660|gb|ABQ36166.1| methionyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
          Length = 722

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 267/507 (52%), Positives = 360/507 (71%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAIAYPN  PHIGHAYE I  D +ARF RLDG DV F TGTDEHG K+ + AQN G
Sbjct: 213 FYVTTAIAYPNGNPHIGHAYEAIATDAIARFARLDGKDVFFLTGTDEHGLKMVQTAQNEG 272

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T      +N+  FRDM + L++S+D FIRTTE  HH + + +W ++ + GDIY   Y+G
Sbjct: 273 LTPGELATRNAGRFRDMDERLNVSFDRFIRTTEPAHHKSVQAIWNRMLENGDIYADTYAG 332

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY +DE   G D      Q  PV+W+EE+ YFFRLSAYQD+LL+ YES P+F
Sbjct: 333 WYSVRDEAYYAEDETVVGEDNVRRGPQGTPVEWVEEKSYFFRLSAYQDRLLALYESQPDF 392

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE+ISFVK GLKDLS+SR TFDWG+++P D +++MYVW+DALTNY+T  G+ D
Sbjct: 393 IGPDARRNEIISFVKGGLKDLSISRTTFDWGVRVPHDDEHVMYVWVDALTNYITGVGFPD 452

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D +  K+WPAD+HVIGKDI+RFHA+YWPAFL+SA +P+PK+V++HGF+ ++GEK+SKS
Sbjct: 453 END-ANWKYWPADVHVIGKDIIRFHAVYWPAFLMSAGVPVPKRVYAHGFLFNRGEKMSKS 511

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  + ++ GVD LRYF +RE+  G+DG Y+ + +  R+NADLAN +GNL  RS+
Sbjct: 512 VGNVVDPFNLADQYGVDQLRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSL 571

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K   G +P PG F+ +D +IL+    ++   R+ M  Q IH+ L  V S+V+E +R
Sbjct: 572 SMIAKQLGGQLPEPGEFSANDRAILAEADAMIGAARKAMATQQIHQWLNAVWSVVAEANR 631

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYVT EVIRQ+AIL Q  +P  + K+ D L + ++ R F
Sbjct: 632 YFAGEAPWALAKTDPKRQHTVLYVTAEVIRQVAILTQPVMPTASAKLLDSLGIPEDERNF 691

Query: 487 QSL--DQRLKPGFMLHKTFDPIFPRFL 511
             L  + R+  G  L      +FPR++
Sbjct: 692 ARLGGEIRIAAGTQLPAP-QAVFPRYI 717


>gi|90424203|ref|YP_532573.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
 gi|90106217|gb|ABD88254.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
          Length = 522

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 360/510 (70%), Gaps = 3/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   ++ST I YPN  PHIGHAY  +++D +ARF RLDG DV F TGTDEHG K+ + A 
Sbjct: 9   RPAYFLSTPIFYPNGVPHIGHAYTAMVSDAIARFQRLDGYDVRFLTGTDEHGLKMQQTAI 68

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T     D+NS  FRDM   L+ISYDD+IRTTE RH  +C+ LW  I + GDIY   
Sbjct: 69  AEGLTPLQLADRNSARFRDMMAALNISYDDYIRTTEPRHERSCQALWTAIENNGDIYLDK 128

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+R EAY+++ E   G DG       +PV+W EEE YFFRLSAYQDKLL  Y   
Sbjct: 129 YAGWYSVRQEAYFDEAETTVGEDGVRREPLGSPVEWTEEETYFFRLSAYQDKLLELYAKV 188

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+LP ER NEV SFVK GL+DLS+SR TFDWGIK+P  P+++MYVWIDALTNY+T  G
Sbjct: 189 PDFVLPRERLNEVASFVKGGLQDLSISRTTFDWGIKVPGAPRHVMYVWIDALTNYITGAG 248

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D    S  ++WPA LHVIGKDI+RFHA+YWPAFL+SA + +P++VFSHGF+L++GEK+
Sbjct: 249 YPDVDSDSFKRYWPASLHVIGKDIVRFHAVYWPAFLMSAGVAVPQRVFSHGFLLNRGEKM 308

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP E+ ++ GVD +RYF +RE++ G+DG Y+ + +  R NADLAN +GNL  
Sbjct: 309 SKSVGNVVDPFEMAKQYGVDQMRYFFMREVSFGQDGSYNHEAIVNRTNADLANDLGNLAQ 368

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS++MI K   G++P PG F+++D++IL+    +++  R  M  Q IH  L  V ++V+E
Sbjct: 369 RSLTMIGKQLGGVLPEPGDFSDNDKAILAQADAMIELARTAMATQQIHHMLNAVWAVVAE 428

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  A K+ D L +A+E 
Sbjct: 429 ANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQVAILAQPVMPASAAKLLDSLGIAEEE 488

Query: 484 RCFQSLD--QRLKPGFMLHKTFDPIFPRFL 511
           R F  L   +R++PG  L     PIFPR++
Sbjct: 489 RDFTHLGGHERIRPGTPLPAP-APIFPRYV 517


>gi|163760146|ref|ZP_02167229.1| methionyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162282545|gb|EDQ32833.1| methionyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 514

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 271/509 (53%), Positives = 363/509 (71%), Gaps = 5/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E+ YI+T I YPN  PHIGHAY  I  DVLARF RLDG DV F +GTDEHGQK+ + A+ 
Sbjct: 4   ERFYITTPIFYPNGVPHIGHAYTAIATDVLARFQRLDGKDVFFLSGTDEHGQKMQQTAEQ 63

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+      D+NS  FRDM + LD S DDFIRTTE+RH  + + LWK++   GDIY G Y
Sbjct: 64  EGIKPIALADKNSAVFRDMLERLDCSNDDFIRTTEERHKASVQELWKRMEANGDIYLGKY 123

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+R EAY+++ E   G DG       +PV+W+EEE Y+FRLSAY DKLL  +E +P
Sbjct: 124 GGWYSVRQEAYFDEGETTLGEDGIRREPLGSPVEWVEEESYYFRLSAYGDKLLELFEKNP 183

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           EF+ P ERRNEV SFVKSGLKDLS+SR TFDWG+ +P + +++MYVW+DALTNY+T  G+
Sbjct: 184 EFVAPAERRNEVASFVKSGLKDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYITAAGF 243

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D     K  +WPA +H+IGKDI+RFHA+YWPAFL+SA L LP KVF+HGF+L KGEK+S
Sbjct: 244 PDE-TSEKWNYWPA-IHMIGKDIVRFHAVYWPAFLMSAGLELPAKVFAHGFLLVKGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP  +I+  G+D +RYF +RE+  G+DG Y  + +  R+N+DLANGIGNL SR
Sbjct: 302 KSIGNVVDPFALIDHYGLDQVRYFFMREVPFGQDGSYSPEAIATRINSDLANGIGNLTSR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            +SMI K+ DG +P  G  T+ D+++L    +V++  R +M +  IH+AL  +I +V++ 
Sbjct: 362 CLSMINKNCDGKVPECGVLTDPDKAMLETADKVIESARADMADFQIHKALTSIIDVVADG 421

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           DRYF +Q+PW LKKT+P R  TVLY+T E +RQ++ILL  F+P+ A K+ D++    + R
Sbjct: 422 DRYFASQEPWALKKTDPARMETVLYITAETVRQISILLLPFMPQSAGKLLDLVAAPADKR 481

Query: 485 CFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
            F +L +  RL PG  + K   PIFPR++
Sbjct: 482 DFAALGETGRLAPGTPIDKP-TPIFPRYV 509


>gi|240141004|ref|YP_002965484.1| methionyl-tRNA synthetase [Methylobacterium extorquens AM1]
 gi|240010981|gb|ACS42207.1| methionyl-tRNA synthetase [Methylobacterium extorquens AM1]
          Length = 522

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 365/512 (71%), Gaps = 5/512 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K  E   I+TAI+YPN  PHIGHAYE+I  D +ARFHRLDG DVLFTTGTDEHG KI + 
Sbjct: 6   KANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGRDVLFTTGTDEHGLKIQQT 65

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AGVT + FVD  +  F+ +AD LD SYD FIRTTE  H+   + LW+++   GDIY 
Sbjct: 66  ASRAGVTPRAFVDDMAGRFKAVADRLDCSYDRFIRTTEADHYAAAQELWRRMEANGDIYL 125

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y+GWYS+RDEAYY++ E   G DG   + + + PV+WMEEE Y FRLS YQ+ LL  Y
Sbjct: 126 AKYAGWYSVRDEAYYDEAETALGPDGNRRSIKTDTPVEWMEEENYLFRLSKYQEPLLKLY 185

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
              P+F+ P  R NEV SFV+SGLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT
Sbjct: 186 AEQPDFLGPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDALTNYLT 245

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D      A+FWPA LH+IGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF L +G
Sbjct: 246 VTGFPDA-QAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFFLSRG 304

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP++++   GVD +RYFL+RE   G DG YD + +  R+NADLAN +GN
Sbjct: 305 EKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGSDGNYDHEAIINRINADLANDLGN 364

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ +G +P PGAFTE+DE +L+  + + ++ R  MQN  +H  LA++ ++
Sbjct: 365 LAQRSLSMIAKNCEGTVPEPGAFTEADERLLAAAAALPEKARGLMQNLALHAILAEIWAV 424

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +++PW+L+K++P R +TVLYVTVE +R++ +++Q FVP     + D+L V 
Sbjct: 425 VGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDLLAVP 484

Query: 481 DENR--CFQSLDQRLKPGFMLHKTFDPIFPRF 510
              R   F   + RL+ G  L     PIFPRF
Sbjct: 485 VNARSFAFTGAEYRLQGGTALPAP-APIFPRF 515


>gi|218532446|ref|YP_002423262.1| methionyl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
 gi|218524749|gb|ACK85334.1| methionyl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
          Length = 522

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 364/512 (71%), Gaps = 5/512 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K  E   I+TAI+YPN  PHIGHAYE+I  D +ARFHRLDG DVLFTTGTDEHG KI + 
Sbjct: 6   KANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGRDVLFTTGTDEHGLKIQQT 65

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AGVT + FVD  +  F+ +AD LD SYD FIRTTE  H+   + LW+++   GDIY 
Sbjct: 66  ASRAGVTPRAFVDDMAGRFKAVADRLDCSYDRFIRTTEADHYAAAQELWRRMEANGDIYL 125

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y+GWYS+RDEAYY++ E   G DG   + + + PV+WMEEE Y FRLS YQ+ LL  Y
Sbjct: 126 AKYAGWYSVRDEAYYDEAETTLGPDGNRRSIKTDTPVEWMEEENYLFRLSKYQEPLLKLY 185

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
              P+F+ P  R NEV SFV+SGLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT
Sbjct: 186 AEQPDFLGPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDALTNYLT 245

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D      A+FWPA LH+IGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF L +G
Sbjct: 246 VTGFPDA-QAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFFLSRG 304

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP++++   GVD +RYFL+RE   G DG YD + +  R+NADLAN +GN
Sbjct: 305 EKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGSDGNYDHEAIINRINADLANDLGN 364

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ +G +P PGAFTE+DE +L+  + + ++ R  MQN  +H  LA++ ++
Sbjct: 365 LAQRSLSMITKNCEGAVPEPGAFTEADERLLAAAAALPEKARGLMQNLALHAILAEIWAV 424

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +++PW+L+K++P R +TVLYVTVE +R++ +++Q FVP     + D+L V 
Sbjct: 425 VGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDLLAVP 484

Query: 481 DENR--CFQSLDQRLKPGFMLHKTFDPIFPRF 510
              R   F   +  L+ G  L     PIFPRF
Sbjct: 485 VNARSFAFTGAEHSLQGGTALPAP-APIFPRF 515


>gi|319405650|emb|CBI79273.1| Methionyl-tRNA synthetase [Bartonella sp. AR 15-3]
          Length = 513

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 266/510 (52%), Positives = 371/510 (72%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN+ PHIGHAY  I++D LARF + DG +V F +GTDEHG K+ + AQ
Sbjct: 2   RDIYYITTPIFYPNSAPHIGHAYNAIVSDALARFQKADGKNVFFLSGTDEHGLKMQQTAQ 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M  +L+ S +DFIRTTE+RHH  C+ LWKK+  KGDIY GC
Sbjct: 62  MLNMTPQQLADRNSAVFQKMLAMLNCSNNDFIRTTEERHHKACQELWKKMEAKGDIYLGC 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R EAYY + +     +G     +  +PV+W EEE YFFRLS Y+  LL +YE 
Sbjct: 122 YAGWYSVRQEAYYEEKDTKIDQEGIRREKELGSPVEWNEEESYFFRLSRYEKALLEHYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P ERRNE+I+FVKSGLKDLS+SR TFDWGI++P +P+++MYVW+DALTNYLT  
Sbjct: 182 YPDFIGPNERRNEIINFVKSGLKDLSISRTTFDWGIRVPGNPKHVMYVWVDALTNYLTAV 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            + D  +  K +FWPAD+H+IGKDI+RFHA+YWPAFL+SA + LPK++F+HGF+L++G K
Sbjct: 242 DFFDE-NSKKRRFWPADIHIIGKDIIRFHAVYWPAFLMSAGIELPKRIFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E++E  G+D +RYF +RE+  G+DG Y+ D    R+NADLAN +GNL 
Sbjct: 301 MSKSVGNVVDPFEMVERYGLDQVRYFFLREVPFGQDGSYNHDNFVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SMI K+ +  IPTP AF   DE +L    +VL+ +R  M +Q  H AL+ + S+V+
Sbjct: 361 QRSLSMIEKNCNMKIPTPAAFLIQDEQLLKQSLQVLEIVRRTMLDQAPHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF +++PW L+K NP+R STVLY+T+EV+R++ I+L  F+P+ A K+ D L VA+E
Sbjct: 421 DANRYFASEEPWSLRKNNPERFSTVLYITLEVLRRVGIMLLPFIPQSAAKLLDSLAVAEE 480

Query: 483 NRCFQSL-DQRLKPGFMLHKTFDPIFPRFL 511
           +R    + D R+K   +L     PIFPR++
Sbjct: 481 DRLLHHISDLRIKEETVLSPPV-PIFPRYI 509


>gi|298291756|ref|YP_003693695.1| methionyl-tRNA synthetase [Starkeya novella DSM 506]
 gi|296928267|gb|ADH89076.1| methionyl-tRNA synthetase [Starkeya novella DSM 506]
          Length = 524

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 270/509 (53%), Positives = 358/509 (70%), Gaps = 1/509 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+TAI YPN  PHIGHAYE I AD LARF +LDG DV F TGTDEHG K+A+ A+
Sbjct: 8   KPAFYITTAIDYPNGAPHIGHAYEKIAADALARFKKLDGYDVFFLTGTDEHGLKMAQTAE 67

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T   +  +N+  F++M  +L + YD FIRTT++ H  + + +W+++ + GDIY G 
Sbjct: 68  KQGLTPIEWATKNATRFKEMDALLGVDYDRFIRTTDEDHILSSQAIWQRMVEAGDIYLGA 127

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           YSGWYS+RDEAYY +DE    ADG     Q  PV+W EE+ YFFRLSAYQ KLL YY++H
Sbjct: 128 YSGWYSVRDEAYYAEDETTVNADGVRLGPQGTPVEWTEEKSYFFRLSAYQQKLLDYYDAH 187

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNEV SFV+SGL+DLS+SR TF WGI +P D  ++MYVW+DALTNY+T  G
Sbjct: 188 PDFIRPDVRRNEVTSFVRSGLQDLSISRTTFTWGIPVPGDEAHVMYVWVDALTNYITGVG 247

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D    S  +FWPADLH+IGKDI+RFHA+YWPAFL+SA +  PK VF+HGFI ++GEK+
Sbjct: 248 YPDTDSASFKRFWPADLHIIGKDIIRFHAVYWPAFLMSAGIAPPKTVFAHGFIHNRGEKM 307

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP ++ +  GVDALRYFL+REI  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 308 SKSVGNVIDPFDLAKAYGVDALRYFLLREIPFGQDGSYSHEAIVARTNADLANDLGNLAQ 367

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+  G +P+PG     D  IL+    +  ++RE M+ Q IH+AL  + ++V++
Sbjct: 368 RSLSMIAKNLSGTLPSPGPLAPDDAEILASADAMGPKVREAMEAQQIHQALGVIWAVVAD 427

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF A  PWEL+KT+P+R  TVL+ T EVIRQ+A+L Q FVP  A K+ D+L ++ + 
Sbjct: 428 ANRYFAASAPWELRKTDPERFGTVLWTTAEVIRQVALLAQPFVPTSAAKLLDLLDISSDA 487

Query: 484 RCFQS-LDQRLKPGFMLHKTFDPIFPRFL 511
           R F S        G  +     P+FPR++
Sbjct: 488 RDFASLGGAGRLAGGTVLPAPAPVFPRYV 516


>gi|154253553|ref|YP_001414377.1| methionyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154157503|gb|ABS64720.1| methionyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 520

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 268/514 (52%), Positives = 355/514 (69%), Gaps = 4/514 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M   +  YI+TAI+YPN  PHIGHAYE+I  DV+AR+ RLDG DV F TG D+HGQK+A+
Sbjct: 1   MSAPKAFYITTAISYPNGPPHIGHAYEVITTDVIARYKRLDGYDVRFLTGVDDHGQKMAQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G T +   D+ +  F  M + L+IS DDFIRTTE RH   C+ LW+KI+ KGDIY
Sbjct: 61  TAKAKGTTPQALADEMAPKFLAMDERLNISNDDFIRTTEARHEKACQHLWEKIAAKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQ-YYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
            G YSGWYS+RDEA+Y++DE+  G  GQ        PV+WMEEE YFFRLSAYQ+KLL+ 
Sbjct: 121 TGTYSGWYSVRDEAFYDEDELTTGEGGQKLAPGTGTPVEWMEEETYFFRLSAYQEKLLAL 180

Query: 180 YESHPEFILPIERRNEVISFVKSGLKDLSLSR--KTFDWGIKIPDDPQYIMYVWIDALTN 237
           YES P+FI P  RRNE+++FVK GL DLS+SR     DWG+ +P DP ++MYVWIDALTN
Sbjct: 181 YESQPDFIQPASRRNEILAFVKRGLNDLSISRARTKLDWGVGVPGDPNHVMYVWIDALTN 240

Query: 238 YLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFIL 297
           Y+T  GY D       ++WPAD+H+IGKDI+RFHA+ WPA L++A + LPK+VF HGF+ 
Sbjct: 241 YITGLGYPDMDGDLFKRYWPADMHIIGKDIVRFHAVIWPAMLMAAEVALPKRVFGHGFLN 300

Query: 298 HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANG 357
            +GEK+SKS+GNVIDP  + +  GVD +RYF  RE+  G DG Y  D +  R+NADLAN 
Sbjct: 301 VRGEKMSKSVGNVIDPFTITDTYGVDPIRYFFCREVTYGADGSYSHDTVVNRINADLAND 360

Query: 358 IGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           IGNL  RS+SMI K+  G +P  GAFT  D+++L   + + ++ RE M+   IH  + +V
Sbjct: 361 IGNLAQRSLSMIAKNCGGEVPAYGAFTAEDKAVLDAAAALPEKTREQMERLEIHSYVGEV 420

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
            ++VSE +RYF  Q+PW LKKT+P+R  TVLYVT EV+R+ A++LQ  +P    K+ D+L
Sbjct: 421 FAVVSEANRYFAGQEPWALKKTDPERMGTVLYVTAEVVRRCALMLQPVMPASIAKLLDLL 480

Query: 478 FVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            V +  R F  +   L PG  L      +FPR++
Sbjct: 481 AVPEGARAFSDIAASLTPGTALPAPAG-VFPRYV 513


>gi|27352779|dbj|BAC49781.1| methionyl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 658

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 262/507 (51%), Positives = 359/507 (70%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ + AQN G
Sbjct: 150 FYITTAIAYPNGNPHIGHAYEAIATDTLARFARLDGKDVFFLTGTDEHGLKMIQTAQNEG 209

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T      +N+  F+ M + L++S+D FIRTTE++HH + + +W+++   GDIY   Y+G
Sbjct: 210 LTPSALAARNAARFKAMDERLNVSFDRFIRTTEEQHHRSTQEIWRRMEANGDIYADTYAG 269

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY +DE     DG     Q  PV+W+EE+ YFFRLSAYQ+KLL  Y  +P+F
Sbjct: 270 WYSVRDEAYYAEDETRLNDDGVRLGPQGTPVEWVEEKSYFFRLSAYQEKLLKLYTDNPDF 329

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFVK GL+DLS+SR TFDWG+K+P D +++MYVW+DALTNY+T  G+ D
Sbjct: 330 IGPDSRRNEVVSFVKGGLRDLSISRTTFDWGVKVPGDEEHVMYVWVDALTNYITGVGFPD 389

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    ++WPAD+H+IGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ ++GEK+SKS
Sbjct: 390 ESD-KNWRYWPADVHIIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNRGEKMSKS 448

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  + ++ GVD +RYF +RE+  G+DG Y+ + +  R+NADLAN +GNL  RS+
Sbjct: 449 VGNVVDPFNLADQYGVDQMRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSL 508

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K   G++P PG F+++D++IL++   ++   RE M  Q IH  L  V ++V+E +R
Sbjct: 509 SMIAKQLGGVLPEPGEFSDNDKAILAMADGMIAASREAMATQQIHHWLNAVWAVVAEANR 568

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  +  + D L V    R F
Sbjct: 569 YFAGEAPWALAKTDPARQKTVLYVTAEVVRQIAILAQPAMPTASGLLLDSLGVPGGERNF 628

Query: 487 QSLD--QRLKPGFMLHKTFDPIFPRFL 511
            +L   +R+ PG  L     P FPR++
Sbjct: 629 AALGGAKRIAPGSTLPAP-TPAFPRYI 654


>gi|161511098|ref|NP_771156.2| methionyl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 543

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 262/507 (51%), Positives = 359/507 (70%), Gaps = 4/507 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAIAYPN  PHIGHAYE I  D LARF RLDG DV F TGTDEHG K+ + AQN G
Sbjct: 35  FYITTAIAYPNGNPHIGHAYEAIATDTLARFARLDGKDVFFLTGTDEHGLKMIQTAQNEG 94

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T      +N+  F+ M + L++S+D FIRTTE++HH + + +W+++   GDIY   Y+G
Sbjct: 95  LTPSALAARNAARFKAMDERLNVSFDRFIRTTEEQHHRSTQEIWRRMEANGDIYADTYAG 154

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEAYY +DE     DG     Q  PV+W+EE+ YFFRLSAYQ+KLL  Y  +P+F
Sbjct: 155 WYSVRDEAYYAEDETRLNDDGVRLGPQGTPVEWVEEKSYFFRLSAYQEKLLKLYTDNPDF 214

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFVK GL+DLS+SR TFDWG+K+P D +++MYVW+DALTNY+T  G+ D
Sbjct: 215 IGPDSRRNEVVSFVKGGLRDLSISRTTFDWGVKVPGDEEHVMYVWVDALTNYITGVGFPD 274

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    ++WPAD+H+IGKDI+RFHA+YWPAFL+SA +P+ K+V++HGF+ ++GEK+SKS
Sbjct: 275 ESD-KNWRYWPADVHIIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNRGEKMSKS 333

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  + ++ GVD +RYF +RE+  G+DG Y+ + +  R+NADLAN +GNL  RS+
Sbjct: 334 VGNVVDPFNLADQYGVDQMRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSL 393

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K   G++P PG F+++D++IL++   ++   RE M  Q IH  L  V ++V+E +R
Sbjct: 394 SMIAKQLGGVLPEPGEFSDNDKAILAMADGMIAASREAMATQQIHHWLNAVWAVVAEANR 453

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  + PW L KT+P R  TVLYVT EV+RQ+AIL Q  +P  +  + D L V    R F
Sbjct: 454 YFAGEAPWALAKTDPARQKTVLYVTAEVVRQIAILAQPAMPTASGLLLDSLGVPGGERNF 513

Query: 487 QSLD--QRLKPGFMLHKTFDPIFPRFL 511
            +L   +R+ PG  L     P FPR++
Sbjct: 514 AALGGAKRIAPGSTLPAP-TPAFPRYI 539


>gi|319407220|emb|CBI80859.1| Methionyl-tRNA synthetase [Bartonella sp. 1-1C]
          Length = 513

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 266/510 (52%), Positives = 367/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN+ PHIGHAY  I++D LARF + DG +V F +GTDEHG K+ + A+
Sbjct: 2   RDIYYITTPIFYPNSAPHIGHAYNAIVSDTLARFQKADGKNVFFLSGTDEHGLKMQQTAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M  VL+ S +DFIRTTE+RHH  C+ LWKK+  KGDIY GC
Sbjct: 62  MLNITPQQLADRNSAVFQKMLAVLNCSNNDFIRTTEERHHKACQELWKKMEAKGDIYLGC 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R E+YY + +     +G     +  +PV+W EEE YFFRLS Y+  LL YYE 
Sbjct: 122 YAGWYSVRQESYYEEKDTEIDQEGIRREKELGSPVEWNEEESYFFRLSRYEKALLQYYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P ERRNE+ISFVKSGLKD+S+SR TFDWGI++P +P+++MYVW+DALTNYLT  
Sbjct: 182 YPDFIGPNERRNEIISFVKSGLKDISISRTTFDWGIRVPGNPKHVMYVWVDALTNYLTGI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            +  N    K  FWPAD+H+IGKDI RFHAIYWPAFL+SA + LPK++F HGF+L++G K
Sbjct: 242 DFF-NETSKKRNFWPADVHIIGKDITRFHAIYWPAFLMSAEIELPKRIFVHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+++  G+D +RYF +REI  G+DG Y+ D    R+NADLAN +GNL 
Sbjct: 301 MSKSIGNVVDPFEMVDRYGLDQVRYFFLREIPFGQDGSYNHDNFVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ +  IPTP AF   DE +L    +VL+ +R+ M NQ  H AL+ + S+V+
Sbjct: 361 QRSLSMVEKNCNMKIPTPAAFLIQDEQLLKQSFQVLEVVRQTMSNQAPHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF  ++PW L+K NP+R  TVLY+T+EV+R++ I+L  F+P+ A K+ D L +A+E
Sbjct: 421 DANRYFANEEPWSLRKNNPERFFTVLYITLEVLRRVGIMLLPFIPQSATKLLDSLAIAEE 480

Query: 483 NRCFQSL-DQRLKPGFMLHKTFDPIFPRFL 511
           +R    + D R+K G +L     PIFPR++
Sbjct: 481 DRLLHHISDLRIKEGTVL-PIPAPIFPRYI 509


>gi|170744506|ref|YP_001773161.1| methionyl-tRNA synthetase [Methylobacterium sp. 4-46]
 gi|168198780|gb|ACA20727.1| methionyl-tRNA synthetase [Methylobacterium sp. 4-46]
          Length = 515

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 269/510 (52%), Positives = 364/510 (71%), Gaps = 5/510 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E+  I+TAI+YPN  PHIGHAYE+I AD +ARF R+DG DV FTTGTDEHG KI + A  
Sbjct: 4   ERFTITTAISYPNGAPHIGHAYEVIAADAIARFKRIDGYDVFFTTGTDEHGLKIQQTAAK 63

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AG++ + FVD  +  FR MA+ L+  +D FIRTT+  H  + + LW+++   GDIY   Y
Sbjct: 64  AGISPRAFVDAMAPRFRTMAETLNCGFDRFIRTTDPDHIASSQALWRRMEAAGDIYLAKY 123

Query: 125 SGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           +GWYS+RDEAYY++ E+  G DG +       PV+W+EEE YFFRLSAY D+LL++Y  H
Sbjct: 124 AGWYSVRDEAYYDEAELVLGQDGVRRAERTGTPVEWVEEESYFFRLSAYADRLLAHYAEH 183

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNEV+SFV+SGL+DLS+SR TFDWG+ +P  P ++MYVW+DALTNY+T+ G
Sbjct: 184 PDFIGPETRRNEVVSFVRSGLQDLSVSRTTFDWGVPVPGAPGHVMYVWVDALTNYITSCG 243

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D  D  + + WPADLHVIGKDI+RFHA+YWPAFL+SA +PLP++VF HGF+L +GEK+
Sbjct: 244 FPDEAD-PRWRRWPADLHVIGKDIIRFHAVYWPAFLMSAGVPLPRRVFGHGFLLSRGEKM 302

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNV+DPI +    GVD LRYF++RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 303 SKSLGNVVDPIALAGLYGVDPLRYFVLREVPFGQDGNYSHEAIVNRTNADLANDLGNLAQ 362

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS++MI ++ DG +P PG   E+D +IL+    +    R  M++  +H ALA++ ++V+E
Sbjct: 363 RSLTMIARNCDGAVPRPGDLAEADRAILAAADALPAVARAAMEDYALHHALAEIWAVVAE 422

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF AQ+PW L+KT+P R +TVLY T E +R + IL+Q FVP  A ++ D+L V  E 
Sbjct: 423 ANRYFAAQEPWTLRKTDPARMATVLYCTAETLRAVGILVQPFVPAAACRLLDLLAVPGEA 482

Query: 484 RCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           R    + +  RL PG  L     PIFPRF+
Sbjct: 483 RGLAQVGEGGRLVPGTALPAP-SPIFPRFV 511


>gi|13470650|ref|NP_102219.1| methionyl-tRNA synthetase [Mesorhizobium loti MAFF303099]
 gi|25009388|sp|Q98MV8|SYM_RHILO RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|14021392|dbj|BAB48005.1| methionyl-tRNA synthetase [Mesorhizobium loti MAFF303099]
          Length = 516

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 268/510 (52%), Positives = 358/510 (70%), Gaps = 5/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           REK Y++T I YPN +PHIGHAY +I  D LARF RLDG DV F TGTDEHG K+ + A+
Sbjct: 3   REKYYLTTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVFFLTGTDEHGLKMQQTAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+NS  FR M + +  S D++IRTTE RH+ +C+ +WK ++  GDIY   
Sbjct: 63  KEGITPQALADRNSAIFRSMTEAVGGSNDEYIRTTEPRHYASCQAIWKAMAANGDIYLDR 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           YSGWYS+R EAY+++ E   G DG       +PV+W EEE YFFRLSAYQDKLL+ YES 
Sbjct: 123 YSGWYSVRQEAYFDESETTLGEDGVRREPLGSPVEWNEEESYFFRLSAYQDKLLALYESQ 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+ P ERRNEV+SFVKSGLKDLS+SR TF WG+ +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PDFVGPAERRNEVMSFVKSGLKDLSISRTTFKWGVPVPGDDKHVMYVWVDALTNYITAAG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D     + ++WPA  H+IGKDI+RFHA+YWPAFL+SA + LPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDT-KSDQWRYWPA-THIIGKDIVRFHAVYWPAFLMSAGIELPKRVFAHGFLFNRGEKM 300

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP  +IE  G+D +RYF +RE+  G+DG Y  D +  R NADLANG+GNL  
Sbjct: 301 SKSVGNVVDPFALIEHYGLDQVRYFFLREVPFGQDGSYSHDAIVNRTNADLANGLGNLAQ 360

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+  G++P  G  T++D +IL      L   R+ M  Q IH ALA +  +V+E
Sbjct: 361 RSLSMIAKNCGGVVPKRGEMTDADSAILDQAVAALTTARKAMAGQGIHLALAAIFDVVAE 420

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            DRYF  Q PW LKKT+P+R  TVL+ T E++R++A+L Q F+P  A K+ D+L V  + 
Sbjct: 421 ADRYFAGQAPWALKKTDPERMETVLWTTAELVRRVAVLCQPFIPGSAAKLLDLLAVPADK 480

Query: 484 RCFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
           R F  +  D  L PG  L    + +FPR++
Sbjct: 481 RDFVHVHADYALVPGTALPAP-EGVFPRYV 509


>gi|188583889|ref|YP_001927334.1| methionyl-tRNA synthetase [Methylobacterium populi BJ001]
 gi|179347387|gb|ACB82799.1| methionyl-tRNA synthetase [Methylobacterium populi BJ001]
          Length = 522

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/512 (53%), Positives = 364/512 (71%), Gaps = 5/512 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           K  E   I+TAI+YPN  PHIGHAYE+I  D +ARFHRLDG +VLFTTGTDEHG KI + 
Sbjct: 6   KANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGREVLFTTGTDEHGLKIQQT 65

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AGVT + FVD  +  F+ +AD LD +YD FIRTTE  H+   + LW+++   GDIY 
Sbjct: 66  AAKAGVTPRAFVDDMAGRFKAVADRLDCAYDRFIRTTEPDHYAAAQELWRRMEANGDIYL 125

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y+GWYS+RDEAYY++ E     DG   +A+ + PV+WMEEE Y FRLS YQ+ LL  Y
Sbjct: 126 AKYAGWYSVRDEAYYDEAETVLAPDGSRRSAKTDTPVEWMEEENYLFRLSKYQEPLLKLY 185

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
              P+F+ P  R NEV SFV+SGLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT
Sbjct: 186 AEQPDFLAPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDALTNYLT 245

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D      A+FWPA LH+IGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF L +G
Sbjct: 246 VTGFPDA-GAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFFLSRG 304

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKSLGNV+DP++++   GVD +RYFL+RE   G DG YD + +  R+NADLAN +GN
Sbjct: 305 EKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGGDGNYDHEAIINRINADLANDLGN 364

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SMI K+ DG +P PG FTE+D  +L+  + + ++ R  MQN  +H  LA++ ++
Sbjct: 365 LAQRSLSMIAKNCDGAVPEPGDFTEADARLLAAAAALPEKARGLMQNLALHAILAEIWAV 424

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF +++PW+L+K++P R +TVLYVTVE +R++ +++Q FVP     + D+L V 
Sbjct: 425 VGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDLLAVP 484

Query: 481 DENR--CFQSLDQRLKPGFMLHKTFDPIFPRF 510
            + R   F   D RL+ G  L     PIFPRF
Sbjct: 485 VDRRSFAFAGEDHRLQGGTALPAP-APIFPRF 515


>gi|170747932|ref|YP_001754192.1| methionyl-tRNA synthetase [Methylobacterium radiotolerans JCM 2831]
 gi|170654454|gb|ACB23509.1| methionyl-tRNA synthetase [Methylobacterium radiotolerans JCM 2831]
          Length = 525

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/510 (54%), Positives = 358/510 (70%), Gaps = 5/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+   +STAI+YPN  PHIGHAYE+I AD +ARFHRLDG DVLF+TGTDEHG KI +AA 
Sbjct: 10  RKTFALSTAISYPNGAPHIGHAYEVIAADAIARFHRLDGYDVLFSTGTDEHGLKIQQAAT 69

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T + FVD  +  F+ MAD +D +YD FIRTTE  H+   + +W+++   GDIY   
Sbjct: 70  RAGTTPRAFVDGTAARFQAMADRMDCAYDRFIRTTEPDHYAAAQEIWRRMEANGDIYLDK 129

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+RDEAYY++ E     DG   + A   PV+WMEEE + FRLSAYQDKLL  Y+ 
Sbjct: 130 YAGWYSVRDEAYYDEAETRLLEDGSRRSLATDTPVEWMEEENFLFRLSAYQDKLLKLYDE 189

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
            P FI P  RRNEV SFV+SGLKDLS+SR  FDWG+ +P  P ++MYVW+DALTNYLT T
Sbjct: 190 QPGFIGPDTRRNEVASFVRSGLKDLSVSRTNFDWGVPVPGHPNHVMYVWVDALTNYLTVT 249

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+ D  D  K +FWP DLHVIGKDI+RFHA+YWPAFL+SA LPLPK+VF HGF+L KGEK
Sbjct: 250 GFPDASDPRK-EFWPMDLHVIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFLLSKGEK 308

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKSLGNV+DP E+ +  GVD +RYF++RE+  G DG Y  + +  R+NADLAN +GNL 
Sbjct: 309 MSKSLGNVLDPFELADTYGVDPVRYFVLREVPFGGDGSYSHEAIIGRINADLANDLGNLA 368

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ DG +P PGA   +D ++L+    +    R  M +  +H  LA++ ++V+
Sbjct: 369 QRSLSMVAKNCDGAVPDPGALDAADTALLAQADALPARARTLMGDLALHTVLAEIWAVVA 428

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E +RYF AQ+PW+L+K++P R + VLY T+E +R   IL Q FVP  A K+ D+L V  +
Sbjct: 429 EANRYFAAQEPWKLRKSDPARMNAVLYTTLESLRVFGILTQPFVPGAAAKLLDLLAVPAD 488

Query: 483 NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            R    + +  RL PG  L     PIFPRF
Sbjct: 489 RRGLADVGEGGRLVPGTALPAP-APIFPRF 517


>gi|319404210|emb|CBI77803.1| Methionyl-tRNA synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 513

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 261/510 (51%), Positives = 367/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN+ PHIGHAY  I++D LARF + DG +V F +GTDEHG K+ + A+
Sbjct: 2   RDIYYITTPIFYPNSAPHIGHAYNAIVSDTLARFQKADGKNVFFLSGTDEHGLKMQQTAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M  VL+ S +DFIRTTE+RHH  C+ LWKK+  KGDIY GC
Sbjct: 62  MLNITPQQLADRNSAVFQKMLAVLNCSNNDFIRTTEERHHKACQELWKKMEAKGDIYLGC 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R E+YY + +     +G     +  +PV+W EEE YFFRLS Y+  LL +YE 
Sbjct: 122 YAGWYSVRQESYYEEKDTEVDQEGVRREKELGSPVEWNEEESYFFRLSRYEKALLQHYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P ERRNE+ISFVKSGLKD+S+SR TFDWGI++P +P+++MYVW+DALTNYLT  
Sbjct: 182 YPDFIGPNERRNEIISFVKSGLKDISISRTTFDWGIRVPGNPKHVMYVWVDALTNYLTGI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            +  N    K  FWPAD+H+IGKDI RFHAIYWPAFL+SA + LPK++F+HGF+L++G K
Sbjct: 242 DFF-NETSKKRNFWPADVHIIGKDITRFHAIYWPAFLMSAEIELPKRIFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+++  G+D +RYF +RE+  G+DG Y+ D    R+NADLAN +GNL 
Sbjct: 301 MSKSIGNVVDPFEMVDCYGLDQVRYFFLREVPFGQDGSYNHDNFVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ +  +PTP AF   DE +L    +VL+ +R+ M NQ  H AL+ + S+V+
Sbjct: 361 QRSLSMVEKNCNMKVPTPAAFLIQDEQLLKQSLQVLEVVRQTMSNQAPHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF  ++PW L+K NP+R  TVLY+T+EV+R++ I+L  F+P+ A K+ D L +A+E
Sbjct: 421 DANRYFANEEPWSLRKNNPERFFTVLYITLEVLRRIGIMLLPFIPQSATKLLDSLAIAEE 480

Query: 483 NRCFQSL-DQRLKPGFMLHKTFDPIFPRFL 511
           +R    + D ++K   +L     PIFPR++
Sbjct: 481 DRLLHHISDLKIKEETVLPPPV-PIFPRYI 509


>gi|111022628|ref|YP_705600.1| methionyl-tRNA synthetase [Rhodococcus jostii RHA1]
 gi|110822158|gb|ABG97442.1| methionine--tRNA ligase [Rhodococcus jostii RHA1]
          Length = 519

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/509 (51%), Positives = 352/509 (69%), Gaps = 2/509 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   Y++TAIAYPN  PHIGHAYE I +D LARF RLDG DV F TGTDEHG K+ + A 
Sbjct: 10  RPPFYLTTAIAYPNGVPHIGHAYEYISSDALARFKRLDGFDVYFMTGTDEHGLKMQQTAA 69

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+  +    +NS  F  M   L+IS+D FIRTT+  H +  + +W+++ D GDIY   
Sbjct: 70  KEGIDVRELAARNSDVFEAMDKTLNISFDRFIRTTDADHEEASKAIWRRMLDNGDIYLDT 129

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           YSGWYS+RDEA+Y + E     DG   + +   PV+W EE  YFF+LS YQDKLL  YE 
Sbjct: 130 YSGWYSVRDEAFYTEAETTLQDDGSRLSTETGTPVEWTEESTYFFKLSEYQDKLLRLYEE 189

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P  RRNE++SFVK GLKDLS+SR TFDWG+ +PD P+++MYVW+DALTNYLT  
Sbjct: 190 NPDFIAPATRRNEIVSFVKGGLKDLSISRTTFDWGVPVPDHPEHVMYVWVDALTNYLTGA 249

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY D       KFWPA+LH+IGKDI RFH +YWPAFL+SA + LPK+VF HGF+ +KGEK
Sbjct: 250 GYPDTDSEQFGKFWPANLHIIGKDITRFHTVYWPAFLMSAGIELPKRVFVHGFLYNKGEK 309

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP+ ++E+ G+DA+R+FL+REI+ G+DG Y  + +  R+NADLAN +GNL 
Sbjct: 310 MSKSVGNVVDPVAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRINADLANELGNLA 369

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ D  +PTPG  TE D ++L+    +L  +R     Q +H AL  + S++ 
Sbjct: 370 QRSLSMVAKNCDAQVPTPGELTEDDTAMLAQADALLGRVRAEYDVQALHLALEAIWSVLG 429

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E +RYF  Q+PW L+KT+P+R +TVLYVT+EV+R + IL+Q  +P  A KI D+L    +
Sbjct: 430 ETNRYFSKQEPWVLRKTDPERMATVLYVTLEVVRIVGILVQPVMPDAAEKILDLLGQKAD 489

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            R F  L  R+  G  L      +FPR++
Sbjct: 490 ARQFSDLSTRIVAGTPLPAP-SGVFPRYV 517


>gi|49474218|ref|YP_032260.1| methionyl-tRNA synthetase [Bartonella quintana str. Toulouse]
 gi|49239722|emb|CAF26101.1| Methionyl-tRNA synthetase [Bartonella quintana str. Toulouse]
          Length = 519

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/510 (51%), Positives = 363/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN+ PHIGHAY  I +D LARF RLDG +V F +GTDEHG K+ + A 
Sbjct: 2   RDTYYITTPIFYPNSTPHIGHAYSAIASDALARFQRLDGKNVFFLSGTDEHGLKMQQTAT 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T K   D+NS  F+ M   L+ S DDFIRTTE+RH+  C+ +WKK+   GDIY GC
Sbjct: 62  ALGMTPKQLADRNSAVFKKMLAALNCSNDDFIRTTEERHYQACQEIWKKMQADGDIYLGC 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y GWYS+R EAYY + E   G D      +  +PV+W EEE YFFRLS Y+  LL +YE 
Sbjct: 122 YKGWYSVRQEAYYEEKETEVGEDNIRREKELGSPVEWNEEESYFFRLSRYEKALLEHYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           HP+FI P+ER NEVISFVKSGLKD+S+SR +F WGI +P +P+++MYVW+DALTNYL+  
Sbjct: 182 HPDFIAPLERYNEVISFVKSGLKDISISRASFHWGICVPGNPKHVMYVWVDALTNYLSAI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+ D  +  K  FWPA++H+IGKDI+RFHA+YWPAFL+SA + LPK+VF+HGF+L++G K
Sbjct: 242 GFFDG-NSKKRDFWPANIHIIGKDIIRFHAVYWPAFLMSAGIALPKRVFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+I+  G+D +RYFL+RE+  G+DG Y  D +  R+NADLAN +GNL 
Sbjct: 301 MSKSIGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYGHDNVVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SMI K+ D  +P P AF   DE +L    + L   R+ M +Q +H AL+ + S+V+
Sbjct: 361 LRSLSMIAKNCDAKVPRPAAFLIQDEQLLKQSLQALDITRQAMSSQEMHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF  ++PW L+K NP+R STVLY+TVE++R++ I+L  F+P+ A K+ D L +++ 
Sbjct: 421 DANRYFANEQPWNLRKNNPERFSTVLYITVEILRRIGIMLLPFMPQSAAKLLDSLAISEN 480

Query: 483 NRCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           +R    +   +++ G  L    +PIFPR++
Sbjct: 481 DRLLYHISHSKIQEGLDLPPP-EPIFPRYI 509


>gi|229494943|ref|ZP_04388694.1| methionyl-tRNA synthetase [Rhodococcus erythropolis SK121]
 gi|229318167|gb|EEN84037.1| methionyl-tRNA synthetase [Rhodococcus erythropolis SK121]
          Length = 532

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 261/510 (51%), Positives = 358/510 (70%), Gaps = 2/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           ER   YI+TAIAYPN  PHIGHAYE I +D LARF RLDG +V F TGTDEHG K+ + A
Sbjct: 22  ERSPFYITTAIAYPNGAPHIGHAYEYISSDALARFKRLDGHEVFFMTGTDEHGLKMQQTA 81

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
              G+  +    +NS  F+++  VL+ISYD FIRTT+  H    + +W+K++  GDIY  
Sbjct: 82  IKEGIDVRELAARNSDVFQNLDKVLNISYDRFIRTTDADHQVASKAIWEKMAASGDIYLD 141

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYE 181
            YSGWYS+RDEA+Y + E     DG   + +   PV+W EE  Y FRLSAY+D+LL+ YE
Sbjct: 142 TYSGWYSVRDEAFYTEAETTLLDDGTRQSTETGTPVEWTEESNYTFRLSAYEDRLLALYE 201

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            HPEFI P  RRNE++SFVK GLKDLS+SR TFDWG+++P DP ++MYVW+DALTNYLT 
Sbjct: 202 EHPEFIAPATRRNEIVSFVKGGLKDLSISRTTFDWGVEVPGDPDHVMYVWVDALTNYLTG 261

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY +       KFWPA LH+IGKDI RFH +YWPAFL+SA + LP++VF HGF+ +KGE
Sbjct: 262 VGYPNVDSAEFEKFWPASLHIIGKDITRFHTVYWPAFLMSAGIELPERVFVHGFLYNKGE 321

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS+GNV+DPI ++++ G+DA+R+FL+REI+ G+DG Y  + +  R+NADL+N +GNL
Sbjct: 322 KMSKSVGNVVDPIAMVDQYGLDAVRFFLLREISYGQDGSYSHEAIVTRMNADLSNELGNL 381

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS++M+ K+ D  +PTPG FTE D ++L+    +L + R     Q +H AL  +  ++
Sbjct: 382 AQRSLTMVAKNCDAQVPTPGEFTEDDLAMLASADALLAKCRSEFDVQALHLALEAIWGVL 441

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            E +RYF  Q+PW L+KT+P R +TVLYVT+EV+R + +L+Q  +P  A++I D+L  ++
Sbjct: 442 GETNRYFSKQEPWVLRKTDPARMATVLYVTLEVVRIVGLLVQPVMPDAASRILDLLGQSE 501

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           ENR F  +  R+     L     P+FPRF+
Sbjct: 502 ENRQFADIAVRIDANRKLPAP-APVFPRFV 530


>gi|319783483|ref|YP_004142959.1| methionyl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169371|gb|ADV12909.1| methionyl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 516

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 354/510 (69%), Gaps = 5/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+K YI+T I YPN +PHIGHAY +I  D LARF RLDG DV F TGTDEHG K+ + A+
Sbjct: 3   RDKFYITTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVFFLTGTDEHGLKMQQTAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T     D+NS  FR M + +  S D +IRTTE RH+++C+ +WK ++  GDIY   
Sbjct: 63  KEGITPLALADRNSAIFRAMTEAMGGSNDQYIRTTEPRHYESCQAIWKAMAANGDIYLDR 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           YSGWYS+R EAY+++ E   G DG       +PV+W EEE YFFRLSAYQDKLL+ YES 
Sbjct: 123 YSGWYSVRQEAYFDESETTLGDDGVRREPLGSPVEWNEEESYFFRLSAYQDKLLALYESQ 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+ P ERRNEV+SFVKSGLKDLS+SR TF WG+ +P D +++MYVW+DALTNY+T  G
Sbjct: 183 PDFVGPTERRNEVLSFVKSGLKDLSISRTTFKWGVPVPGDDKHVMYVWVDALTNYITAAG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D     +  +WPA  H+IGKDI+RFHA+YWPAFL+SA + LPK+VF+HGF+ ++GEK+
Sbjct: 243 YPDT-KAEQWHYWPA-THIIGKDIVRFHAVYWPAFLMSAGIELPKRVFAHGFLFNRGEKM 300

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP  ++E  G+D +RYF +RE+  G DG Y  D +  R NADLANG+GNL  
Sbjct: 301 SKSVGNVVDPFAMVEHYGLDQVRYFFLREVPFGNDGSYSHDAIVNRTNADLANGLGNLAQ 360

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SMI K+  G++P  G  T++D +IL   +  L   R+ +  Q IH ALA +  +V+E
Sbjct: 361 RSLSMIAKNCGGVVPQRGELTDADRAILDQAAAALDIARKAVAEQGIHLALAAIFGVVAE 420

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            DRYF  + PW LKKTN  R  TVL+ T EV+R++A+L Q F P  A K+ D+L V  E+
Sbjct: 421 ADRYFAGEAPWALKKTNLARMETVLWTTAEVVRRVAVLCQPFTPGSAAKLLDLLAVPAES 480

Query: 484 RCFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
           R F  +  D  L PG  L    + +FPR++
Sbjct: 481 RDFVHVHADHALVPGTAL-PVPEGVFPRYV 509


>gi|226365134|ref|YP_002782917.1| methionyl-tRNA synthetase [Rhodococcus opacus B4]
 gi|226243624|dbj|BAH53972.1| methionyl-tRNA synthetase [Rhodococcus opacus B4]
          Length = 519

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 259/509 (50%), Positives = 354/509 (69%), Gaps = 2/509 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   Y++TAIAYPN  PHIGHAYE I +D LARF RLDG DV F TGTDEHG K+ + A 
Sbjct: 10  RPPFYLTTAIAYPNGVPHIGHAYEYISSDALARFKRLDGFDVYFMTGTDEHGLKMQQTAA 69

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+  +    +NS  F  M   L+IS+D FIRTT+  H +  + +W+++ + GDIY   
Sbjct: 70  KEGIDVRELAARNSDVFEAMDKTLNISFDRFIRTTDADHEEASKAIWQRMLEAGDIYLDT 129

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           YSGWYS+RDEA+Y + E     DG   + +   PV+W EE  YFF+LS YQDKLL+ Y+ 
Sbjct: 130 YSGWYSVRDEAFYTEAETTLQEDGSRLSTETGTPVEWTEESTYFFKLSEYQDKLLALYDE 189

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P  RRNE++SFVK GLKDLS+SR TFDWG+ +P  P+++MYVW+DALTNYLT  
Sbjct: 190 NPDFIAPATRRNEIVSFVKGGLKDLSISRTTFDWGVPVPGHPEHVMYVWVDALTNYLTGA 249

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY D       KFWPA+LH+IGKDI RFH +YWPAFL+SA + LPK+VF HGF+ +KGEK
Sbjct: 250 GYPDTDSEQFGKFWPANLHIIGKDITRFHTVYWPAFLMSAGIELPKRVFVHGFLYNKGEK 309

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP+ ++E+ G+DA+R+FL+REI+ G+DG Y  + +  R+NADLAN +GNL 
Sbjct: 310 MSKSVGNVVDPVAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRINADLANELGNLA 369

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ D  +PTPGA T+ D ++L+    +L+ +R     Q +H AL  + S++ 
Sbjct: 370 QRSLSMVAKNCDAQVPTPGALTDDDTAMLAQADALLERVRAEYDVQALHLALEAIWSVLG 429

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E +RYF  Q+PW L+KT+P+R +TVLYVT+EV+R + IL+Q  +P  A KI D+L    +
Sbjct: 430 ETNRYFSKQEPWVLRKTDPERMATVLYVTLEVVRIVGILVQPVMPDAAEKILDLLGQKSD 489

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            R F  L  R+  G  L      +FPR++
Sbjct: 490 ARQFSDLPARIVAGTPLPAP-SGVFPRYV 517


>gi|54026880|ref|YP_121122.1| methionyl-tRNA synthetase [Nocardia farcinica IFM 10152]
 gi|54018388|dbj|BAD59758.1| putative methionyl-tRNA synthetase [Nocardia farcinica IFM 10152]
          Length = 518

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 263/510 (51%), Positives = 355/510 (69%), Gaps = 8/510 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAIAYPN  PHIGHAYE I AD +ARF RLDG DV F TGTDEHGQK+ +AA   G
Sbjct: 8   FYVTTAIAYPNGAPHIGHAYEYISADAIARFKRLDGYDVFFMTGTDEHGQKMQQAAAAEG 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +  +    +NS  F  +   LD+SYD FIRTT+  H      +W+++   GDIY   Y+G
Sbjct: 68  IPVQDLAARNSDVFERLDKALDVSYDRFIRTTDADHRAASVAIWERMLANGDIYLDNYAG 127

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEA+Y ++E     DG   + +   PV W EE  +FFRLS YQD+LL++YE HPE
Sbjct: 128 WYSVRDEAFYTEEETTLLEDGSRISTETKTPVTWTEESNFFFRLSKYQDRLLAHYEEHPE 187

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNE++S+VK+GLKDLS+SR TFDWG+ +P  P ++MYVW+DALTNYLT  G+ 
Sbjct: 188 FIAPATRRNEIVSYVKAGLKDLSISRTTFDWGVPVPGHPDHVMYVWVDALTNYLTGVGFP 247

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D    +  KFWPAD+H+IGKDI RFH +YWPAFL+SA +PLPK+VF HGF+ +KGEK+SK
Sbjct: 248 DTDSPAFRKFWPADVHIIGKDITRFHTVYWPAFLMSAGVPLPKRVFVHGFLYNKGEKMSK 307

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GNV+DP+E+++E G+DA+R+FL+REI+ G+DG Y  D +  R+NADLAN  GNLV RS
Sbjct: 308 SVGNVVDPLELVDEYGLDAVRFFLLREISYGQDGSYSHDAIVARINADLANEFGNLVQRS 367

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           ++M+ K+ D  +PTPG FT  D ++L   + +L+  R     Q +H AL  +   + E +
Sbjct: 368 LTMVHKNCDAAVPTPGEFTAEDRALLDRAAGLLERCRAEFDAQQMHLALEAIWLTLGETN 427

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           RYF AQ+PW L+K+  +    R +TVLYVT+EV+R +AIL+Q  +P  A +I D+L  A 
Sbjct: 428 RYFSAQQPWALRKSGTEADLARMATVLYVTLEVVRIVAILVQPVMPGSAGRILDLL--AQ 485

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           + R F  L   L PG  L    +P+FPR++
Sbjct: 486 QGRTFADLATPLTPGTPLPAP-EPVFPRYV 514


>gi|226307854|ref|YP_002767814.1| methionyl-tRNA synthetase [Rhodococcus erythropolis PR4]
 gi|226186971|dbj|BAH35075.1| methionyl-tRNA synthetase [Rhodococcus erythropolis PR4]
          Length = 532

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 260/510 (50%), Positives = 357/510 (70%), Gaps = 2/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           ER   YI+TAIAYPN  PHIGHAYE I +D LARF RLDG +V F TGTDEHG K+ + A
Sbjct: 22  ERSPFYITTAIAYPNGAPHIGHAYEYISSDALARFKRLDGHEVFFMTGTDEHGLKMQQTA 81

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
              G+  +    +NS  F+++  VL+ISYD FIRTT+  H    + +W+K++  GDIY  
Sbjct: 82  IKEGIDVRELAARNSDVFQNLDKVLNISYDRFIRTTDADHQVASKAIWEKMAASGDIYLD 141

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYE 181
            YSGWYS+RDEA+Y + E     DG   + +   PV+W EE  Y FRLSAY ++LL+ YE
Sbjct: 142 TYSGWYSVRDEAFYTESETTLLEDGTRQSTETGTPVEWTEESNYTFRLSAYGERLLALYE 201

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            HPEFI P  RRNE++SFVK GLKD+S+SR TFDWG+K+P DP ++MYVW+DALTNYLT 
Sbjct: 202 EHPEFIAPTTRRNEIVSFVKGGLKDISISRTTFDWGVKVPGDPDHVMYVWVDALTNYLTG 261

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY +       KFWPA LH+IGKDI RFH +YWPAFL+SA + LP++VF HGF+ +KGE
Sbjct: 262 VGYPNVDSEEFKKFWPASLHIIGKDITRFHTVYWPAFLMSAGIELPERVFVHGFLYNKGE 321

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS+GNV+DPI ++++ G+DA+R+FL+REI+ G+DG Y  + +  R+NADL+N +GNL
Sbjct: 322 KMSKSVGNVVDPIAMVDQYGLDAVRFFLLREISYGQDGSYSHEAIVTRMNADLSNELGNL 381

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS++M+ K+ D  +PTPG FTE D ++L+    +L + R     Q +H AL  +  ++
Sbjct: 382 AQRSLTMVAKNCDAQVPTPGEFTEDDLAMLASADALLAKCRSEFDVQALHLALEAIWGVL 441

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            E +RYF  Q+PW L+KT+P R +TVLYVT+EV+R + +L+Q  +P  A++I D+L  ++
Sbjct: 442 GETNRYFSKQEPWVLRKTDPARMATVLYVTLEVVRIVGLLVQPVMPDAASRILDLLGQSE 501

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           ENR F  +  R+     L     P+FPRF+
Sbjct: 502 ENRQFADIAVRIDANRKLPAP-APVFPRFV 530


>gi|49475612|ref|YP_033653.1| methionyl-tRNA synthetase [Bartonella henselae str. Houston-1]
 gi|49238419|emb|CAF27646.1| Methionyl-tRNA synthetase [Bartonella henselae str. Houston-1]
          Length = 519

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 260/506 (51%), Positives = 361/506 (71%), Gaps = 4/506 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I YPN  PHIGHAY  I +DVLARF RLDG +V F +GTDEHG K+ + A   G+
Sbjct: 6   YITTPIFYPNGAPHIGHAYSAIASDVLARFQRLDGKNVFFLSGTDEHGLKMQQTAVALGI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K   D+NS  F+ M   L+ S +DFIRTTEKRH+  C+ +WKK+   GDIY   Y+GW
Sbjct: 66  TPKQLTDRNSAVFQKMLAALNCSNNDFIRTTEKRHYQACQEIWKKMKANGDIYLSRYTGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+R EAYY + +   G D      +  +PV+W EEE YFF+LS Y+  LL +YE HP+F
Sbjct: 126 YSVRQEAYYEEKDTEVGEDNIRREKELGSPVEWNEEESYFFKLSRYEKALLEHYEKHPDF 185

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P ERRNEVISF+KSGLKD+S+SR +F+WGI +P+D +++MYVW+DALTNYL+  G+ D
Sbjct: 186 IAPPERRNEVISFIKSGLKDISISRASFNWGICVPNDSKHVMYVWVDALTNYLSAIGFFD 245

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             +  K  FWPA +H+IGKDI+RFHAIYWPAFL+SA + LPK++F+HGF+L+ G K+SKS
Sbjct: 246 E-NSKKRAFWPASVHIIGKDIIRFHAIYWPAFLMSAGIALPKRIFAHGFLLNNGVKMSKS 304

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP E+I+  G+D +RYFL+RE+  G+DG Y  D    R+NADLAN +GNL  RS+
Sbjct: 305 IGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYSHDSFVNRINADLANDLGNLAQRSL 364

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K+ D  +P P AF   DE +L    + L  +R+ M +Q IH AL+ + S+V++ +R
Sbjct: 365 SMIAKNCDAKVPLPAAFLVQDEQLLEKSLQTLDTMRKAMSSQEIHLALSAIFSVVADANR 424

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  ++PW L+K NP+R STVLY+T+E++R++ I+L  F+P+ A K+ D L ++ E+R  
Sbjct: 425 YFANEQPWSLRKNNPERFSTVLYITLEILRRIGIMLLPFMPQSAAKLLDSLKISQEDRLL 484

Query: 487 QSL-DQRLKPGFMLHKTFDPIFPRFL 511
           Q + + +++ G  L    +PIFPR++
Sbjct: 485 QHISNSKIQEGLDLPPP-EPIFPRYI 509


>gi|304391677|ref|ZP_07373619.1| methionyl-tRNA synthetase [Ahrensia sp. R2A130]
 gi|303295906|gb|EFL90264.1| methionyl-tRNA synthetase [Ahrensia sp. R2A130]
          Length = 513

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/509 (51%), Positives = 356/509 (69%), Gaps = 4/509 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +K YI+TAI+YPN  PHIGHAYE I AD +ARF RLDG DV F  GTD HGQK+ + A++
Sbjct: 3   QKYYITTAISYPNGAPHIGHAYEFICADAIARFKRLDGYDVRFQIGTDVHGQKMFQTARD 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T K   D+NS  F+ M +   IS+D FIRT+++ HH   + +W  +   GDIYK  Y
Sbjct: 63  LGITPKELADKNSDAFQSMTEHYGISWDRFIRTSDEDHHRASQAIWSAMEANGDIYKDAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           +GWYS+RDEAYY +DE     DG+    Q +PV+W+EEE YFFRLSAY DKLL+ ++  P
Sbjct: 123 AGWYSVRDEAYYEEDETRLTEDGKRLGPQGSPVEWVEEESYFFRLSAYGDKLLALFDEQP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  R+NE++SFVK GL+DLS+SR TFDWG+K+P D +++MYVW+DALTNYLT  GY
Sbjct: 183 DFIAPASRKNEIVSFVKGGLRDLSISRTTFDWGVKVPGDDKHVMYVWVDALTNYLTGAGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D  +     +WPADLHVIGKDI RFHA+YWPAFL+SA + LPK+V+ HGF+L  GEK+S
Sbjct: 243 PDT-ESELWSYWPADLHVIGKDITRFHAVYWPAFLMSAGIDLPKRVYGHGFLLANGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGNV DP+++  E G+DA+RY+  R +  G DG Y  D +    NADLAN  GNL  R
Sbjct: 302 KSLGNVADPMDLAAEYGIDAMRYYCQRLVRFGSDGSYSHDDIVNHTNADLANNFGNLAQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SMI K+ DG +   GAFTE+D ++L+    +L   R+ +   + + AL  + + +   
Sbjct: 362 SLSMIFKNCDGKLDGAGAFTEADTALLATADGMLAPCRDAIDRTVPNEALDAIWATLDAA 421

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYFD Q PW LKKT+P+R +TVLYVT EV+RQ++IL+QAF+P+ A K+ D L + ++ R
Sbjct: 422 NRYFDEQAPWGLKKTDPERMATVLYVTAEVVRQVSILVQAFLPESAEKLLDQLKIPEDQR 481

Query: 485 CFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            F  L  D RL    ++ K  + +FPR++
Sbjct: 482 DFAYLGGDNRLDTATVIEKP-EGVFPRYV 509


>gi|163868324|ref|YP_001609533.1| methionyl-tRNA synthetase [Bartonella tribocorum CIP 105476]
 gi|161017980|emb|CAK01538.1| Methionyl-tRNA synthetase [Bartonella tribocorum CIP 105476]
          Length = 519

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 365/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN  PHIGHAY  I +DVLARF RL+G  V F +GTDEHG K+ + A 
Sbjct: 2   RDTYYITTPIFYPNGHPHIGHAYSAIASDVLARFQRLNGKKVFFLSGTDEHGLKMQQTAA 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M  VL+ S DDFIRTTE+RH+  C+ +WKK+ + GDIY G 
Sbjct: 62  ALDMTPQQLADRNSAVFQKMLAVLNCSNDDFIRTTEERHYQACQEIWKKMEENGDIYLGR 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R EAYY + +   G D      +  +PV+W EEE YFFRLS Y+  LL YYE 
Sbjct: 122 YTGWYSVRQEAYYEEKDTEVGPDNIRREKELGSPVEWNEEESYFFRLSRYEKALLEYYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           HP+FI P+ERRNE+ISF+KSGLKD+S+SR +F+WG+ +P++P+++MYVW+DALTNYL+  
Sbjct: 182 HPDFIAPLERRNEIISFIKSGLKDISISRASFNWGVAVPENPKHVMYVWVDALTNYLSAI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            +  N +  K  FWPA+ H+IGKDI+RFHA+YWPAFL+SA + LPK +F+HGF+L++G K
Sbjct: 242 DFF-NKNSKKRNFWPANTHIIGKDIIRFHAVYWPAFLMSAGIELPKNIFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+I+  G+D +RYFL+RE+  G+DG Y+ + L  R+NADLAN +GNL 
Sbjct: 301 MSKSVGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYNHESLVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SMI K+ D  +P P AF   D+ +L    +VL+ + + M    +H AL+ + S V+
Sbjct: 361 QRSLSMIAKNCDAKVPKPAAFLVQDKQLLEQSLQVLETVHQAMSFHSMHLALSAIFSTVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF  ++PW L+K++P+R STVLY+TVE++R++ I+L  F+P+ A K+ D L VA++
Sbjct: 421 DANRYFANEQPWSLRKSDPERFSTVLYITVEILRRIGIMLLPFIPQSAAKLLDSLAVAED 480

Query: 483 NRCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           +R    +   +++ G  L    +PIFPR++
Sbjct: 481 DRLLYHIAHAKIQEGLDLPPP-EPIFPRYI 509


>gi|296140917|ref|YP_003648160.1| methionyl-tRNA synthetase [Tsukamurella paurometabola DSM 20162]
 gi|296029051|gb|ADG79821.1| methionyl-tRNA synthetase [Tsukamurella paurometabola DSM 20162]
          Length = 516

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 251/512 (49%), Positives = 360/512 (70%), Gaps = 2/512 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M   +  Y++TAIAYPN  PHIGHAYE I  D +ARF RLDG DV F TGTDEHG K+ +
Sbjct: 1   MAADKAFYVTTAIAYPNGVPHIGHAYEYIATDTIARFKRLDGFDVFFLTGTDEHGLKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA   G+ TK   D+N+  F  +   +  ++D FIRTT+  H+   + +W+K++ +GDIY
Sbjct: 61  AAAKEGIETKALADRNAAAFEALQRAVGSTFDRFIRTTDTDHYAASQAIWEKLAARGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
              ++GWYS+RDEAYY +DE     DG     +   PV+W EE  YFFRLSAYQDKLL  
Sbjct: 121 LDTFAGWYSVRDEAYYAEDETALLEDGTRAAISTGTPVEWTEEASYFFRLSAYQDKLLEL 180

Query: 180 YESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           +E++P ++ P  RRNE++SF+K GLKDLS+SR TFDWG+ +P DP ++MYVW+DALTNYL
Sbjct: 181 FETNPGYLEPATRRNEIVSFIKGGLKDLSISRTTFDWGVPVPGDPDHVMYVWVDALTNYL 240

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T +GY D      A++WP  L +IGKDI+RFHA+YWPAFL+SA + LP++VF+HGF+ +K
Sbjct: 241 TGSGYPDTSSEQFARYWPPRLQMIGKDIIRFHAVYWPAFLMSAGIELPERVFAHGFLFNK 300

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           GEK+SKS+GNV+DP ++I   G+DA+R+FL+RE++ G+DG Y  + +  R+NADLAN +G
Sbjct: 301 GEKMSKSVGNVVDPYQLIAAYGLDAVRFFLLREVSFGQDGSYSHEAIVGRINADLANELG 360

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NL  RS+SMI K+  G +P PG FT  D ++L+    +L  +R ++  Q +H  L  + +
Sbjct: 361 NLAQRSLSMINKNCAGTVPAPGEFTADDTALLAKADDLLATVRRHVDQQALHLYLESIWA 420

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           ++++ +RYF AQ+PW+LK ++P R +TVLYVT EV+RQ+A+LLQ  +P+   ++  +L  
Sbjct: 421 VLADTNRYFSAQEPWKLKASDPARMATVLYVTAEVVRQVALLLQPVMPESTEELLTLLEQ 480

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
             + R F+++  RL+PG  L K    +FPR++
Sbjct: 481 PRDERTFEAVATRLRPGTALPKP-QGVFPRYV 511


>gi|169628221|ref|YP_001701870.1| methionyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]
 gi|169240188|emb|CAM61216.1| Methionyl-tRNA synthetase (MetG) [Mycobacterium abscessus]
          Length = 523

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 357/515 (69%), Gaps = 10/515 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAIAYPN +PHIGHAYE +  D +ARF RLDG DV + TGTDEHG K+A+ A  
Sbjct: 6   DPFYITTAIAYPNGEPHIGHAYEYVATDAVARFKRLDGFDVRYLTGTDEHGLKVAQTAAA 65

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AG+ T      NS  F  +   L+IS+D FIRTT+  H++  + +W+K++D GDIY   Y
Sbjct: 66  AGIPTAQLARHNSDVFEALQRTLNISFDRFIRTTDPDHYEASKAIWRKMADNGDIYLDTY 125

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           SGWYS+RDEAYY D E     DG         PV W EE  YFFRLSAYQDKLL++YE+H
Sbjct: 126 SGWYSVRDEAYYTDAETTVAPDGTRTATATGTPVDWTEEHSYFFRLSAYQDKLLAHYEAH 185

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNEV+SFV  GL+DLS+SR TFDWG+ +PD+P+++MYVW+DALTNYLT  G
Sbjct: 186 PEFIGPDVRRNEVVSFVSGGLRDLSISRTTFDWGVPVPDNPEHVMYVWVDALTNYLTGVG 245

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D       ++WPA++H+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+ +KGEK+
Sbjct: 246 YPDTDSELFGRYWPANIHMIGKDIIRFHTVYWPAFLMSAGIALPQRVFAHGFLTNKGEKM 305

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DPI ++   G+D +RYFL+RE+  G+DG Y ++GL  R+NADLAN +GNL  
Sbjct: 306 SKSIGNVVDPINLVNTFGLDQVRYFLLREVPFGQDGSYTEEGLIGRINADLANELGNLAQ 365

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SM+ K+  G++P PG F   D  +L+    +L++ R + +   +H AL  +  ++  
Sbjct: 366 RSLSMVAKNLGGIVPEPGEFAPEDTELLAAADTLLEQARTHFEVPAMHLALEAIWQVLGA 425

Query: 424 VDRYFDAQKPWELKKT--------NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
            +RYF AQ+PW L K+        + +R  TVLY T+EV+R +A+L+Q  +P+ A K+ D
Sbjct: 426 SNRYFSAQEPWVLAKSFQTDGSAADQERFGTVLYTTLEVVRIVALLVQPVMPESAAKLLD 485

Query: 476 ILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           +L  AD+ R F ++  RLKPG  L      +FP++
Sbjct: 486 LLGQADDQRDFAAIGTRLKPGVSLPAPTG-VFPKY 519


>gi|240850631|ref|YP_002972031.1| methionyl-tRNA synthetase [Bartonella grahamii as4aup]
 gi|240267754|gb|ACS51342.1| methionyl-tRNA synthetase [Bartonella grahamii as4aup]
          Length = 519

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 253/510 (49%), Positives = 365/510 (71%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN  PHIGHAY  I +DVLARF RL+G +V F +GTDEHG K+ + A 
Sbjct: 2   RDTYYITTPIFYPNGAPHIGHAYSAIASDVLARFQRLNGKNVFFLSGTDEHGLKMQQTAA 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T +   D+NS  F+ M  VL+ S DDFIRTTE+RH+  C+ +WKK+   GDIY G 
Sbjct: 62  ALGMTPQQLADRNSAVFQKMLAVLNCSNDDFIRTTEERHYQACQEIWKKMEANGDIYLGR 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R EAYY + +   G D      +  +PV+W EEE YFFRLS Y+  LL YYE 
Sbjct: 122 YTGWYSVRQEAYYEEKDTEIGPDNIRREKELGSPVEWNEEESYFFRLSHYEKALLEYYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           HP+FI P+ERRNE+ISF+KSGLKD+S+SR +F+WGI +P++P+++MYVW+DALTNYL+  
Sbjct: 182 HPDFIAPLERRNEIISFIKSGLKDISISRASFNWGIAVPENPKHVMYVWVDALTNYLSAI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+  N +  K  FWPA+ H+IGKDI+RFHA+YWPAFL+SA + LPK +F+HGF+L++G K
Sbjct: 242 GFF-NENSKKRDFWPANTHIIGKDIIRFHAVYWPAFLMSAGIELPKNIFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+++  G+D +RYFL+RE+  G+DG Y  + L  R+NADLAN +GNL 
Sbjct: 301 MSKSIGNVVDPFEMVDHYGLDQVRYFLLREVPFGQDGSYSHESLVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R +SMI K+ +  +P P +F   D+ +L    +VL+ + + M +  +H AL+ + S+V+
Sbjct: 361 QRCLSMIAKNCNAQVPRPTSFLAQDKQLLEQSLQVLETVHQAMSSYSMHLALSAIFSIVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF  ++PW L+K + +R STVLY+TVE++R++ I+L  F+P+ A K+ D L VA++
Sbjct: 421 DANRYFANEQPWSLRKNDQERFSTVLYITVEILRRIGIMLLPFIPQSAAKLLDSLAVAED 480

Query: 483 NRCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           +R    +   +++ G  L    +PIFPR++
Sbjct: 481 DRLLYHISHSKIQEGLDLPPP-EPIFPRYI 509


>gi|319898928|ref|YP_004159021.1| Methionyl-tRNA synthetase [Bartonella clarridgeiae 73]
 gi|319402892|emb|CBI76443.1| Methionyl-tRNA synthetase [Bartonella clarridgeiae 73]
          Length = 513

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 261/510 (51%), Positives = 354/510 (69%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN  PHIGHAY  I++D LARF R DG DV F +GTDEHG K+ + AQ
Sbjct: 2   RDIYYITTPIFYPNGTPHIGHAYNAIVSDALARFQRADGKDVFFLSGTDEHGLKMQQTAQ 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M ++L+ S +DFIRTTEKRHH   + LWKK+  KGDIY G 
Sbjct: 62  MLNITPQQLADRNSAVFQKMLEILNCSNNDFIRTTEKRHHQASQELWKKMEAKGDIYLGR 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+  EAYY + +      G     + N PV+W EEE YFFRLS Y+  LL +YE 
Sbjct: 122 YTGWYSVSQEAYYEEKDTEIDEKGIRREKELNSPVEWNEEESYFFRLSRYEKALLQHYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+ I P ERRNE+ISF+KSGLKDLS+SR TFDWG+++P +P+++MYVW+DALTNYLT  
Sbjct: 182 YPDSIGPNERRNEIISFIKSGLKDLSISRTTFDWGVRVPGNPKHVMYVWVDALTNYLTAI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            + D     K  FWPAD+H+IGKDI+RFH +YWPAFL+S  + LPK++F+HGF+L++G K
Sbjct: 242 DFFDE-TSQKRNFWPADIHIIGKDIIRFHTVYWPAFLMSVGIELPKRIFAHGFLLNRGVK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+++  G+D +RYF +RE+  G DG YD D    R+NADLAN +GNL 
Sbjct: 301 MSKSIGNVVDPFEMVDRYGLDQVRYFFLREVPFGHDGNYDHDSFVNRINADLANDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SMI K+ +  IPTP AF   DE +L    + L+  R+ M  Q  H AL+ + S+V+
Sbjct: 361 QRSLSMIQKNCNAKIPTPAAFLIQDEQLLKQSLQALEIARQTMSRQAPHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E +RYF  ++PW L K NP+R  TVLY+T+E++R++ I+L  F+P+ A K+ D L VA E
Sbjct: 421 EANRYFANEEPWRLHKNNPERFFTVLYITLEILRRIGIMLLPFIPQSATKLLDSLVVAKE 480

Query: 483 NRCFQSL-DQRLKPGFMLHKTFDPIFPRFL 511
           NR    + D ++K    L     PIFPR++
Sbjct: 481 NRFLHHISDLKIKEDTELPSPV-PIFPRYI 509


>gi|311113865|ref|YP_003985087.1| methionine--tRNA ligase [Rothia dentocariosa ATCC 17931]
 gi|310945359|gb|ADP41653.1| methionine--tRNA ligase [Rothia dentocariosa ATCC 17931]
          Length = 515

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/508 (52%), Positives = 360/508 (70%), Gaps = 8/508 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI+YPN  PHIGHAYE I ADVLARF RLDG DV F TGTDEHGQK+   A+  G
Sbjct: 6   FYITTAISYPNGNPHIGHAYETIAADVLARFKRLDGFDVRFMTGTDEHGQKMQTTAEKQG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T K   D+NS  F+ M D L ISYD FIRTT+  H++  + +WK++ + GDIY   Y+G
Sbjct: 66  KTAKELADENSARFKAMNDALGISYDRFIRTTDPDHYEASQAIWKRMEENGDIYLDKYAG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEAYY +DE  +  DGQ Y  +    V+W EEE YFFRLS Y DKLL  Y++   
Sbjct: 126 WYSVRDEAYYAEDETEE-RDGQRYAISTGTEVEWTEEESYFFRLSKYADKLLELYKNEG- 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           ++ P  RRNE+ISFVK GL DLS+SR TFDWG+ +P + +++MYVW+DALTNYLT  GY 
Sbjct: 184 YVFPESRRNELISFVKGGLNDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTGLGY- 242

Query: 246 DNPDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            N DG    K+WPADLH+IGKDI RFH+IYWPAFL SA L LPK+VF HGF+L  GEK+S
Sbjct: 243 PNTDGELFTKYWPADLHLIGKDITRFHSIYWPAFLWSAGLELPKRVFGHGFLLVNGEKMS 302

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP +++   G+D +R+FL+RE++ G+DG Y ++ +  R+N+DLAN +GNL  R
Sbjct: 303 KSVGNVVDPADLVAAFGLDQVRFFLMREVSFGQDGSYSEESIINRINSDLANNLGNLAQR 362

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SM+ K+ DG +PTPG FTE+D  IL+  S + + +R +   Q  HRAL ++ +++++ 
Sbjct: 363 SLSMVAKNCDGRVPTPGEFTEADRKILAGASALYEPVRADYDEQAFHRALERIWTVLADT 422

Query: 425 DRYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-E 482
           + YF  Q+PW L+K    +R +TVLYVT+EV+RQ+AIL+Q  +P    K+ D+L VA+ E
Sbjct: 423 NAYFAEQEPWTLRKNGEFERMNTVLYVTLEVVRQVAILMQPVMPGSMEKLLDLLGVAEGE 482

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F +L + L  G  L     P+FPR+
Sbjct: 483 ERLFAALPKNLTAGKELPAP-TPVFPRY 509


>gi|120405753|ref|YP_955582.1| methionyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]
 gi|119958571|gb|ABM15576.1| methionyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]
          Length = 511

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 255/507 (50%), Positives = 348/507 (68%), Gaps = 2/507 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAIAYPN  PH+GHAYE I  D +ARF RLDG DV F TGTD HG K+A+ A  
Sbjct: 3   EPYYITTAIAYPNGDPHVGHAYEYIATDAVARFKRLDGFDVRFLTGTDVHGLKMAETAAK 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            GV T      NS  F+ + + L IS+D FIRT++  H++  + +W+++ D GD+Y G Y
Sbjct: 63  LGVPTAELARSNSDVFQRLQEKLHISFDRFIRTSDPDHYEASKAIWRRMVDAGDVYLGKY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           SGWYS+RDE ++ + E    A G +       PV W EEE YFFRLSAY D+LL+ Y  H
Sbjct: 123 SGWYSVRDERFFTEAETSVDAAGVRIATETGTPVTWTEEETYFFRLSAYADRLLALYADH 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNEV+SFV  GL+DLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT  G
Sbjct: 183 PEFIEPEVRRNEVVSFVSGGLRDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D       ++WPADLH++GKDI+RFH +YWPAFL+SA + LPKKVF HGF+L++GEK+
Sbjct: 243 FPDTDSELFTRYWPADLHMVGKDIIRFHTVYWPAFLMSAGIELPKKVFVHGFLLNRGEKM 302

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP+ +++  G+D +RYF +RE+  G+DG Y +D +  R+NADLAN  GNL  
Sbjct: 303 SKSVGNVVDPVNLVDTFGLDQVRYFFLREVPFGQDGSYSEDAIIGRINADLANEFGNLAQ 362

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SM+ K+ DG++P PGAFT  D  +L+    +L+ +R + +   +H AL  + S++  
Sbjct: 363 RSLSMVAKNLDGVVPQPGAFTAEDSEMLAAADALLERVRRHFEATAMHLALEAIWSVLGA 422

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF AQ+PW L+KT+P R +TVLY T+EV+R  A+L Q  +P  A K+ D+L    + 
Sbjct: 423 ANRYFSAQEPWVLRKTDPARFATVLYTTLEVVRIAALLSQPVMPDAAAKLLDLLGQPADR 482

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           R F ++  RL PG  L      +FPR+
Sbjct: 483 RAFTAIGTRLAPGTALPSPTG-VFPRY 508


>gi|300741759|ref|ZP_07071780.1| methionine--tRNA ligase [Rothia dentocariosa M567]
 gi|300380944|gb|EFJ77506.1| methionine--tRNA ligase [Rothia dentocariosa M567]
          Length = 515

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/508 (52%), Positives = 359/508 (70%), Gaps = 8/508 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI+YPN  PHIGHAYE I ADVLARF RLDG DV F TGTDEHGQK+   A+  G
Sbjct: 6   FYITTAISYPNGNPHIGHAYETIAADVLARFKRLDGFDVRFMTGTDEHGQKMQTTAEKQG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T K   D+NS  F+ M D L ISYD FIRTT+  H++  + +WK++ + GDIY   Y+G
Sbjct: 66  KTAKELADENSARFKAMNDALGISYDRFIRTTDPDHYEASQAIWKRMEENGDIYLDKYAG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEAYY +DE  +  DGQ Y  +    V+W EEE YFFRLS Y DKLL  Y++   
Sbjct: 126 WYSVRDEAYYAEDETEE-RDGQRYAISTGTEVEWTEEESYFFRLSKYADKLLDLYKNEG- 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           ++ P  RRNE+ISFVK GL DLS+SR TFDWG+ +P + +++MYVW+DALTNYLT  GY 
Sbjct: 184 YVFPESRRNELISFVKGGLNDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTGLGY- 242

Query: 246 DNPDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            N DG    K+WPADLH+IGKDI RFH+IYWPAFL SA L LPK+VF HGF+L  GEK+S
Sbjct: 243 PNTDGELFTKYWPADLHLIGKDITRFHSIYWPAFLWSAGLELPKRVFGHGFLLVNGEKMS 302

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP +++   G+D +R+FL+RE++ G+DG Y ++ +  R+N+DLAN +GNL  R
Sbjct: 303 KSVGNVVDPADLVAAFGLDQVRFFLMREVSFGQDGSYSEESIINRINSDLANNLGNLAQR 362

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SM+ K+ DG +P PG FTE+D  IL+  S + + +R +   Q  HRAL ++ +++++ 
Sbjct: 363 SLSMVAKNCDGRVPVPGEFTEADRKILAGASALYEPVRADYNEQAFHRALERIWTVLADT 422

Query: 425 DRYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-E 482
           + YF  Q+PW L+K    +R +TVLYVT+EV+RQ+AIL+Q  +P    K+ D+L VA+ E
Sbjct: 423 NAYFAEQEPWTLRKNGEFERMNTVLYVTLEVVRQVAILMQPVMPNSMEKLLDLLGVAEGE 482

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F +L + L  G  L     P+FPR+
Sbjct: 483 GRLFAALPKNLTAGKELPAP-TPVFPRY 509


>gi|220926667|ref|YP_002501969.1| methionyl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
 gi|219951274|gb|ACL61666.1| methionyl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
          Length = 515

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/510 (52%), Positives = 361/510 (70%), Gaps = 5/510 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E+  I+TAI+YPN  PHIGHAYE+I  D +ARF R+DG DV FTTGTDEHG KI + A  
Sbjct: 4   ERFTITTAISYPNGAPHIGHAYEVIATDAIARFKRIDGYDVFFTTGTDEHGLKIQQTAAK 63

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AGVT + FVD  +  FR MA+ L+ S+D FIRTT+  H    + LW+++ + GDIY   Y
Sbjct: 64  AGVTPRAFVDAMAPRFRAMAEALNCSFDRFIRTTDPDHVAASQALWRRMEEAGDIYLSKY 123

Query: 125 SGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           SGWYS+RDEAYY++ E+  G DG +       PV+W+EEE YFFRLSAY D+LL++Y  +
Sbjct: 124 SGWYSVRDEAYYDESELVLGPDGVRCAERTGTPVEWVEEESYFFRLSAYADRLLAHYAEN 183

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNEV+SFV+SGL+DLS+SR TFDWG+ +P  P ++MYVW+DALTNY+T+ G
Sbjct: 184 PDFIGPETRRNEVVSFVRSGLQDLSVSRTTFDWGVPVPGAPGHVMYVWVDALTNYITSCG 243

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D  D  + + WPADLHVIGKDI+RFHA+YWPAFL+SA + LPK+VF HGF+L +GEK+
Sbjct: 244 FPDEGD-PRWRHWPADLHVIGKDIIRFHAVYWPAFLMSAGVALPKRVFGHGFLLSRGEKM 302

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNV+DP+E+    GVD LRYF++RE+  G+DG Y  + +  R NADLAN +GNL  
Sbjct: 303 SKSLGNVVDPVELAGLYGVDPLRYFVLREVPFGQDGNYSHEAIVNRTNADLANDLGNLAQ 362

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS++MI ++  G +P PGA  E+D ++L+    +    R  M +  +H ALA++ ++V+E
Sbjct: 363 RSLTMIARNCGGAVPEPGALIEADRALLAAADALPAAARAAMTDYALHHALAEIWAVVAE 422

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            +RYF  Q+PW L+KT+P R  TVLYVT E +R + IL+Q FVP  A K+ D+L    + 
Sbjct: 423 ANRYFAGQEPWTLRKTDPARMGTVLYVTAETLRAIGILVQPFVPAAAAKLLDLLATPKQA 482

Query: 484 RCFQSLDQ--RLKPGFMLHKTFDPIFPRFL 511
           R    + +  RL PG  L     PIFPRF+
Sbjct: 483 RGLAQVGEGNRLVPGTALPAP-SPIFPRFV 511


>gi|182678510|ref|YP_001832656.1| methionyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634393|gb|ACB95167.1| methionyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 530

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 255/511 (49%), Positives = 359/511 (70%), Gaps = 4/511 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  R + Y++TAI Y N  PHIGHAYE +  D + RF RLDG DVLF TG DEHGQK+ +
Sbjct: 15  MAGRPRFYLTTAIPYANGAPHIGHAYERLACDAITRFKRLDGYDVLFVTGMDEHGQKMQQ 74

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A    +T +   D+ +  F  M   LD   DD +RTTE RHH   + +W +++  GDIY
Sbjct: 75  TAARDHITPQELADRTAAQFAAMGLALDAPTDDVVRTTEPRHHVAAQEIWNRMAANGDIY 134

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              Y GWYS+RDEA++++ E+ +G +G        PV+W+EEE Y+F+LSAYQ++LL++Y
Sbjct: 135 LSKYPGWYSVRDEAFFDEGELTEGPNGTKLAPTGAPVEWVEEESYYFKLSAYQERLLAHY 194

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++HP+FI P + RNE++SFV+ GL DLS+SR TFDWGI +P D +++MYVW+DALTNY+T
Sbjct: 195 QAHPDFITPEKYRNEIVSFVERGLTDLSISRSTFDWGIPVPGDAKHVMYVWVDALTNYIT 254

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            TG+ D  +  +A FWPAD HVIGKDI RFHAIYWPAFL+SA + LPK++  HGF+ ++G
Sbjct: 255 ATGFPDA-EAPRAVFWPADAHVIGKDITRFHAIYWPAFLMSAGIALPKQIVVHGFLFNRG 313

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GNVIDP+ +IE  G+D  RYF +RE+  G+DG Y  + +  R NADLAN +GN
Sbjct: 314 EKMSKSVGNVIDPLTLIETYGLDPFRYFFLREVPFGQDGNYSHEAIVNRTNADLANDLGN 373

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SM+ K+  G +P PGAF+E+D++IL +   ++++ R+ MQ+  +H  L ++  +
Sbjct: 374 LAQRSLSMLAKNCGGKVPQPGAFSEADKAILDLSRALVEKSRDLMQDFSLHLILGEIWRV 433

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V E +RYF  ++PW  +KT+P R  T+LYVT EV+R++AIL Q F+P+ A+K+ D L VA
Sbjct: 434 VGEANRYFAGEEPWIKRKTDPARMETILYVTAEVLRRVAILTQPFIPQSASKLLDSLGVA 493

Query: 481 DENRCFQSLDQR--LKPGFMLHKTFDPIFPR 509
            E R F  +++   L PG +L  T  PIFPR
Sbjct: 494 AEARLFIHVEEGPDLPPGTVL-PTPVPIFPR 523


>gi|145222520|ref|YP_001133198.1| methionyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]
 gi|315442968|ref|YP_004075847.1| methionyl-tRNA synthetase [Mycobacterium sp. Spyr1]
 gi|145215006|gb|ABP44410.1| methionyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]
 gi|315261271|gb|ADT98012.1| methionyl-tRNA synthetase [Mycobacterium sp. Spyr1]
          Length = 514

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 253/504 (50%), Positives = 348/504 (69%), Gaps = 2/504 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPN  PH+GHAYE I  D +ARF RLDG DV F TGTD HG K+A+ A   GV
Sbjct: 6   YVTTAIAYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDVHGLKMAETAARLGV 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T      NS  F+ + + L++S+D FIRT++  H++  + +W ++ D GD+Y   YSGW
Sbjct: 66  PTAELARSNSDVFQRLQEKLNVSFDRFIRTSDADHYEASKAIWTRMVDAGDVYLDKYSGW 125

Query: 128 YSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+RDE ++ + E   GADG +       PV W EEE YFFRLSAY D+LL+ Y   P+F
Sbjct: 126 YSVRDERFFTEAETSIGADGVRIATETGTPVTWTEEETYFFRLSAYTDRLLALYAERPDF 185

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE++SFV  GL+DLS+SR TFDWG+ +P  P ++MYVW+DALTNYLT  G+ D
Sbjct: 186 IEPEVRRNEIVSFVSGGLRDLSISRTTFDWGVPVPGHPDHVMYVWVDALTNYLTGVGFPD 245

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
               +  ++WPADLH+IGKDI+RFHA+YWPAFL+SA + LPKKVF+HGF+ ++GEK+SKS
Sbjct: 246 TDSETFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPKKVFAHGFLFNRGEKMSKS 305

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP +++E  GVD LRYFL+RE++ G+DG Y +DG+  R+NADLAN  GNL  RS+
Sbjct: 306 VGNVVDPNDLVETFGVDQLRYFLLREVSFGQDGSYSEDGIIARINADLANEFGNLAQRSL 365

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+ DG +P PG FT  D ++L+    +L  +RE+     +H AL  + S++   +R
Sbjct: 366 SMVAKNLDGAVPEPGEFTAEDTAMLAAADDLLDRVREHYDATAMHLALEAIWSVLGAANR 425

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF AQ+PW L+KT+P R +TVLY T+EV+R  A+L Q  +P     + D+L   ++ R F
Sbjct: 426 YFSAQEPWVLRKTDPGRFATVLYTTLEVVRIAALLSQPVMPGTMATLLDLLGQPEDRRAF 485

Query: 487 QSLDQRLKPGFMLHKTFDPIFPRF 510
            ++  RL PG  L      +FPR+
Sbjct: 486 SAITVRLTPGTALPAPTG-VFPRY 508


>gi|323136445|ref|ZP_08071527.1| methionyl-tRNA synthetase [Methylocystis sp. ATCC 49242]
 gi|322398519|gb|EFY01039.1| methionyl-tRNA synthetase [Methylocystis sp. ATCC 49242]
          Length = 520

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 259/494 (52%), Positives = 341/494 (69%), Gaps = 6/494 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M ER    ISTAI Y N  PHIGHAYE I  D  ARF RLDG DVLF TG DEHGQK+ +
Sbjct: 1   MSERPTYMISTAIPYANGAPHIGHAYERIATDAFARFKRLDGYDVLFVTGMDEHGQKMQR 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G+T +   D+ +  F  M + L+   DD +RTT++RH +T   +W+++   GDIY
Sbjct: 61  TAEKEGLTPQGLADRTAAQFARMGEALNARADDIVRTTQERHKETVLEIWRRMEANGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEAYY++ E+ +  +G+ +     PV+W+EEE +FFRLSAY  KLL++Y
Sbjct: 121 LSKYSGWYSVRDEAYYDESELTE-REGKKFAPTGTPVEWVEEESWFFRLSAYAGKLLAHY 179

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQ----YIMYVWIDALT 236
           E++P+FI P   RNE+I+FVK GL DLS+SR TFDWGI IP  PQ    ++MYVW+DALT
Sbjct: 180 EANPDFITPEHYRNEIIAFVKRGLSDLSVSRTTFDWGIPIPPSPQTTANHVMYVWVDALT 239

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY+T TG+L    G +A+FWPAD HVIGKDI RFHAIYWP+FLLSA  PLPK++  HGF+
Sbjct: 240 NYITATGWLTG-KGERARFWPADAHVIGKDITRFHAIYWPSFLLSAGAPLPKQIVVHGFL 298

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
             +GEK+SKSLGNV+DP+E+ E  GVD LRYF +REI  G+DG Y  + +  R+NADLAN
Sbjct: 299 FSRGEKMSKSLGNVVDPLELAERYGVDQLRYFFLREIPFGQDGNYSHEAIVNRINADLAN 358

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL  RS+SMI K+  G +P  G  T++D  IL+  +  L + R  M +   H ALA+
Sbjct: 359 DLGNLAQRSLSMIGKNCAGAVPKKGELTDADRDILAQAAIALDKARTAMNDYAPHHALAE 418

Query: 417 VISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
           +  +V+E +RYF  ++PW  KKT+P R  T+LYVT E +R+LAI LQ F+P  A K+ D+
Sbjct: 419 IFRVVAEANRYFAGEEPWSKKKTDPARMETILYVTAETLRRLAIPLQPFIPDAAGKLLDL 478

Query: 477 LFVADENRCFQSLD 490
           L V  + R F   D
Sbjct: 479 LGVGPDERDFAHAD 492


>gi|209964481|ref|YP_002297396.1| methionyl-tRNA synthetase MetG [Rhodospirillum centenum SW]
 gi|209957947|gb|ACI98583.1| methionyl-tRNA synthetase MetG [Rhodospirillum centenum SW]
          Length = 520

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 257/512 (50%), Positives = 353/512 (68%), Gaps = 3/512 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  R   Y++T I Y N  PHIGHAY  +  DV+ARF RLDG DV F TGTDEHGQK+ K
Sbjct: 1   MTGRTPYYLTTPIYYVNDAPHIGHAYTTVACDVMARFKRLDGFDVKFLTGTDEHGQKVQK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           +A+ AG+T K   D+NS NFR++A +L++S DDFIRTTE RH    + LW+++ + GD+Y
Sbjct: 61  SAELAGITPKQMADRNSENFRELARLLNVSNDDFIRTTEPRHVTAVQALWQRLQESGDVY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
            G YSGWYS+RDEAY+ +DE+ +  DG+ +     PV+W+EE  YFFRLSA+Q++LL  Y
Sbjct: 121 LGSYSGWYSVRDEAYFGEDELVE-RDGRRFAPTGAPVEWVEEPSYFFRLSAWQERLLELY 179

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ES P+FILP  +R+EV+SFV+ GL+DLS+SR TFDWGI +P D +++MYVW+DALTNY+T
Sbjct: 180 ESRPDFILPAGKRSEVVSFVRGGLRDLSISRTTFDWGIPVPGDEKHVMYVWLDALTNYIT 239

Query: 241 TTGYLDNPDGS-KAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
             GY +  +G+   +FWPADLH++GKDILRFHA+YWPAFL++A L  P++VF+HG+   +
Sbjct: 240 AIGYPETGEGTLYGRFWPADLHMVGKDILRFHAVYWPAFLMAAGLEPPRRVFAHGWWTVE 299

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           GEK+SKSLGNV+ P E+I   G+D  RYFL+REI  G DG + +  + +R+N +LAN  G
Sbjct: 300 GEKMSKSLGNVVKPEELIGTYGLDQTRYFLMREIPFGNDGDFSRRAMVQRINGELANDYG 359

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NLV R +SM+ +  +G +P P AF E D  +L     +L  +R  +  Q  H+AL  +  
Sbjct: 360 NLVQRVLSMVQRYCEGRLPEPAAFGEPDNRLLDAAKGLLPAVRAELDQQAFHKALDTIWQ 419

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +V + +RY D Q PW L+KT+  R  TVLY   E IR++A+L Q F+P+ + +I D L V
Sbjct: 420 VVGDANRYVDEQAPWSLRKTDTVRLGTVLYTLAETIRRVALLTQPFMPETSARILDQLVV 479

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           A + R F   D  L  G  L     P FPR++
Sbjct: 480 AADARSFADFDTVLAAGVQLPPP-QPAFPRYV 510


>gi|56551988|ref|YP_162827.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543562|gb|AAV89716.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 521

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/507 (51%), Positives = 356/507 (70%), Gaps = 3/507 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI+YPN +PHIGHAYE I +D LAR+HRL G DV F TGTDEHG K+A+ A+N
Sbjct: 3   QSFYITTAISYPNGKPHIGHAYEAIASDALARYHRLAGDDVYFQTGTDEHGLKMAQTARN 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             +      D+ S +F+ M DV +ISYD FIRTTE  H+   + LWK ++D G IY G Y
Sbjct: 63  RDIEPIALADEMSSHFKTMDDVYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLGRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y ++E+   + G+  + Q  PV+W  EE +FFRLSA+QDKLL+YYE+HP
Sbjct: 123 EGWYSIRDEAFYKEEELVTDSKGEKLSPQGTPVEWNVEESWFFRLSAFQDKLLAYYEAHP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEVISFVKSGL DLS+SR +FDWGI +PD P ++MYVWIDALTNYLT  GY
Sbjct: 183 DFIQPEARRNEVISFVKSGLADLSISRTSFDWGIPVPDSPGHVMYVWIDALTNYLTGAGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            DN +    ++WPAD+HVIGKDI+RFHA+YWPAFL++A++ LPKKVF HGF+L++GEK+S
Sbjct: 243 PDNKERFD-RYWPADIHVIGKDIIRFHAVYWPAFLMAADIALPKKVFGHGFLLNRGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DPI++ +  GVD +RYFL+RE+  G+DG Y  + +  R+NADLAN  GNL  R
Sbjct: 302 KSVGNVVDPIDMAKLYGVDQIRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+S+I K+    +P+P      D++++   + +  ++   M N   ++AL  +   V E 
Sbjct: 362 SLSIIAKN-GAKVPSPEDTRAEDQALMEKIAGIPHQVATAMNNVAPNQALDAIWRGVGEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y   Q PW ++KT+P RA T+LY T+E +RQLAIL +  +P   + + D+L    + R
Sbjct: 421 NLYISEQAPWTVRKTDPVRADTILYWTIEAVRQLAILCRWAMPASCDALLDLLGQGADQR 480

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            F++L   L PG  L K    +FPRF+
Sbjct: 481 DFRALSAPLVPGLPLPKPVG-VFPRFV 506


>gi|241761929|ref|ZP_04760014.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373609|gb|EER63181.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 521

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/507 (51%), Positives = 356/507 (70%), Gaps = 3/507 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI+YPN +PHIGHAYE I +D LAR+HRL G DV F TGTDEHG K+A+ A+N
Sbjct: 3   QSFYITTAISYPNGKPHIGHAYEAIASDALARYHRLAGDDVYFQTGTDEHGLKMAQTARN 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             +      D+ S +F+ M DV +ISYD FIRTTE  H+   + LWK ++D G IY G Y
Sbjct: 63  RDIEPIALADEMSSHFKTMDDVYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLGRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y ++E+   + G+  + Q  PV+W  EE +FFRLSA+QDKLL+YYE+HP
Sbjct: 123 EGWYSIRDEAFYKEEELVTDSKGEKLSPQGTPVEWNVEESWFFRLSAFQDKLLAYYEAHP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEVISFVKSGL DLS+SR +FDWGI +PD P ++MYVWIDALTNYLT  GY
Sbjct: 183 DFIQPEARRNEVISFVKSGLADLSISRTSFDWGIPVPDSPGHVMYVWIDALTNYLTGAGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            DN +    ++WPAD+HVIGKDI+RFHA+YWPAFL++A++ LPKKVF HGF+L++GEK+S
Sbjct: 243 PDNKERFD-RYWPADIHVIGKDIIRFHAVYWPAFLMAADIALPKKVFGHGFLLNRGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DPI++ +  GVD +RYFL+RE+  G+DG Y  + +  R+NADLAN  GNL  R
Sbjct: 302 KSVGNVVDPIDMAKLYGVDQIRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+S+I K+    +P+P      D++++   + +  ++   M N   ++AL  +   V E 
Sbjct: 362 SLSIITKN-GAKVPSPEDTRAEDQALMEKIAGIPHQVATAMNNVAPNQALDAIWRGVGEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y   Q PW ++KT+P RA T+LY T+E +RQLAIL +  +P   + + D+L    + R
Sbjct: 421 NLYISEQAPWTVRKTDPVRADTILYWTIEAVRQLAILCRWAMPASCDALLDLLGQGADQR 480

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            F++L   L PG  L K    +FPRF+
Sbjct: 481 DFRALSAPLVPGLPLPKPVG-VFPRFV 506


>gi|218510040|ref|ZP_03507918.1| methionyl-tRNA synthetase [Rhizobium etli Brasil 5]
          Length = 439

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 249/434 (57%), Positives = 336/434 (77%), Gaps = 3/434 (0%)

Query: 80  FRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDD 139
           F+ MA +L+ S DDFIRTT++RHH+T R +W  +++ GDIYK  Y+GWYS+RDEAYY ++
Sbjct: 3   FQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIYKDSYAGWYSVRDEAYYQEN 62

Query: 140 EVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISF 199
           E    ADG  Y  Q  PV+W+EE  YFF+LS YQDKLL++YE++P+FI P ERRNEVISF
Sbjct: 63  ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHYEANPDFIGPAERRNEVISF 122

Query: 200 VKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPAD 259
           VKSGLKDLS+SR TFDWGIK+P+DP ++MYVW+DALTNY+T TGY+++ +G +AK+WPAD
Sbjct: 123 VKSGLKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYITATGYIEDRNGPRAKYWPAD 182

Query: 260 LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEE 319
           +H+IGKDI+RFHA+YWPAFL+SA LPLPK+VF+HGF+L+KGEK+SKSLGNV+DP+ ++  
Sbjct: 183 VHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNH 242

Query: 320 VGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPT 379
            G+D +RYF +RE++ G+DG Y ++ +  R+N+DLANGIGNL SRS+SMI+K+ DG IP 
Sbjct: 243 FGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGNLASRSLSMIVKNCDGKIPE 302

Query: 380 PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKT 439
            G  T+ D+++L+    +    RE+M  Q IHRALA +I++VSE DRYF  Q PW LKKT
Sbjct: 303 CGLLTDEDKAMLAQADALHASTREDMGKQQIHRALASIIAVVSETDRYFAGQAPWALKKT 362

Query: 440 NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQ--RLKPGF 497
           +P R  TVLYVT EV+RQ+AILLQ F+P  + K+ D++    + R F +L +  RL  G 
Sbjct: 363 DPVRMGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDLVAAPADKRDFAALGEAGRLVAGT 422

Query: 498 MLHKTFDPIFPRFL 511
            L     P+FPR++
Sbjct: 423 PLEAP-TPVFPRYV 435


>gi|260752469|ref|YP_003225362.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551832|gb|ACV74778.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 521

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/507 (51%), Positives = 356/507 (70%), Gaps = 3/507 (0%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI+YPN +PHIGHAYE I +D LAR+HRL G DV F TGTDEHG K+A+ A+N
Sbjct: 3   QSFYITTAISYPNGKPHIGHAYESIASDALARYHRLAGDDVYFQTGTDEHGLKMAQTARN 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             +      D+ S +F+ M DV +ISYD FIRTTE  H+   + LWK ++D G IY G Y
Sbjct: 63  RDIEPIALADEMSSHFKTMDDVYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLGRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y ++E+   + G+  + Q  PV+W  EE +FFRLSA+QDKLL+YYE+HP
Sbjct: 123 EGWYSIRDEAFYKEEELVTDSKGEKLSPQGTPVEWNVEESWFFRLSAFQDKLLAYYEAHP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEVISFVKSGL DLS+SR +FDWGI +PD P ++MYVWIDALTNYLT  GY
Sbjct: 183 DFIQPEARRNEVISFVKSGLADLSISRTSFDWGIPVPDSPGHVMYVWIDALTNYLTGAGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            DN +    ++WPAD+HVIGKDI+RFHA+YWPAFL++A++ LPKKVF HGF+L++GEK+S
Sbjct: 243 PDNKERFD-RYWPADIHVIGKDIIRFHAVYWPAFLMAADIALPKKVFGHGFLLNRGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DPI++ +  GVD +RYFL+RE+  G+DG Y  + +  R+NADLAN  GNL  R
Sbjct: 302 KSVGNVVDPIDMAKLYGVDQIRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+S+I K+    +P+P      D++++   + +  ++   M N   ++AL  +   V E 
Sbjct: 362 SLSIIAKN-GAKVPSPEDTRAEDQALMEKIAGIPHQVATAMNNVAPNQALDAIWRGVGEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y   Q PW ++KT+P RA ++LY T+E +RQLAIL +  +P   + + D+L    + R
Sbjct: 421 NLYISEQAPWTVRKTDPVRADSILYWTIEAVRQLAILCRWAMPASCDALLDLLGQGADQR 480

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            F++L   L PG  L K    +FPRF+
Sbjct: 481 DFRALSAPLVPGLPLPKPVG-VFPRFV 506


>gi|121601643|ref|YP_989109.1| methionyl-tRNA synthetase [Bartonella bacilliformis KC583]
 gi|120613820|gb|ABM44421.1| methionyl-tRNA synthetase [Bartonella bacilliformis KC583]
          Length = 519

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 255/506 (50%), Positives = 353/506 (69%), Gaps = 4/506 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I YPN  PHIGHAY  I +D LARF RLD  +V F +GTDEHG K+ K A+   +
Sbjct: 6   YITTPIFYPNGAPHIGHAYNAIASDALARFQRLDRKNVFFLSGTDEHGLKMQKTAEALNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T +   D+NS  F+ M   L+ S DDFIRTTE+RHH TC+++WKK+   GDIY   Y+GW
Sbjct: 66  TPQQLADRNSALFQKMLTALNCSNDDFIRTTEERHHQTCQVMWKKMEANGDIYLDRYAGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+R E+YY   +     +G     +  +PV+W EEE YFFRLS Y D LL +YE +P+F
Sbjct: 126 YSVRQESYYEQKDTEIRENGIRCEKELGSPVEWNEEESYFFRLSRYGDALLEHYEKYPDF 185

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P ERRNE+ISFVKSGLKD+S+SR  F+WG+ +P++P+++MYVW+DALTNYLT  G+ D
Sbjct: 186 IGPNERRNEIISFVKSGLKDISISRINFNWGVSVPNNPEHVMYVWVDALTNYLTAIGFFD 245

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           N    K  +WPA++HV+GKDI+RFHAIYWPAFLLSA + LPK++F+HGF+ ++GEK+SKS
Sbjct: 246 N-TAQKRDYWPANVHVVGKDIIRFHAIYWPAFLLSAGIELPKRIFAHGFLFNRGEKMSKS 304

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP ++I+  GVD +RYF +RE+  G+DG Y  D L  RVNADLAN +GNL  RS+
Sbjct: 305 IGNVVDPFKMIDHYGVDQVRYFFLREVPFGQDGSYSHDSLVNRVNADLANDLGNLAQRSL 364

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+ D  +P P  F   D+ +L    + L+  R+ M  Q  H AL+ + S+++  +R
Sbjct: 365 SMLQKNCDAKVPVPDTFLTQDQQLLEQSLQALEVARQTMSCQAPHLALSAIFSVIANANR 424

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF +++PW L+K NP R  TVLYVTVE +R++ I+L  F+P+ A K+ D L + ++NR  
Sbjct: 425 YFASEEPWSLRKNNPKRFCTVLYVTVESLRRIGIMLLPFIPQSAAKLLDSLAIPEDNRLL 484

Query: 487 QSLDQ-RLKPGFMLHKTFDPIFPRFL 511
             +   R++ G  L    + IFPR++
Sbjct: 485 HHISSLRIEEGTDLPPP-EAIFPRYI 509


>gi|283457812|ref|YP_003362406.1| methionyl-tRNA synthetase [Rothia mucilaginosa DY-18]
 gi|283133821|dbj|BAI64586.1| methionyl-tRNA synthetase [Rothia mucilaginosa DY-18]
          Length = 514

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 265/507 (52%), Positives = 356/507 (70%), Gaps = 6/507 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI+YPN  PHIGHAYE I ADVLARF RLDG DV F TGTDEHGQK+   A+  G
Sbjct: 6   FYITTAISYPNGNPHIGHAYETIAADVLARFKRLDGFDVRFMTGTDEHGQKMQTTAEKLG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T K   D+NS  F+ M D L+ISYD FIRTT+  H+   + +WK++ + GDIY   Y+G
Sbjct: 66  KTAKELADENSARFKAMNDALNISYDRFIRTTDPDHYVASQAIWKRMEENGDIYLDKYAG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEAYY +DE  +  DGQ Y  A    V+W EEE YFFRLS Y DKLL  Y ++  
Sbjct: 126 WYSVRDEAYYAEDET-EVRDGQRYAIATGTEVEWTEEESYFFRLSKYGDKLLELY-ANEG 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE+ISFVK GL DLS+SR TFDWG+ +P + +++MYVW+DALTNY+T  GY 
Sbjct: 184 FVYPESRRNELISFVKGGLNDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYITGLGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  +   AK+WPADLH+IGKDI RFH+IYWPAFL SA + LPK+VF HGF+L  GEK+SK
Sbjct: 244 DTDNELFAKYWPADLHLIGKDITRFHSIYWPAFLWSAGIELPKRVFGHGFLLVNGEKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GNV+DP  +++  G+DA+R+FL+RE++ G+DG Y ++ +  R+N+DLAN +GNL  RS
Sbjct: 304 SVGNVVDPANLVDAFGLDAVRFFLMREVSFGQDGSYSEESIINRINSDLANNLGNLAQRS 363

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SM+ K+  G +P  G FTE+D  IL   + + + +R +   Q  HRAL ++ +++++ +
Sbjct: 364 LSMVAKNCGGAVPAHGEFTEADRQILDEAAALYEPVRADFDEQAFHRALDRIWTVLADTN 423

Query: 426 RYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-EN 483
            YF  Q+PW L+K    DR +TVLYVT+EV+RQ+A+LLQ  +P    K+  +L V + E+
Sbjct: 424 AYFAEQEPWTLRKNGELDRMNTVLYVTLEVVRQVALLLQPVMPDSTAKLLTLLGVPEGES 483

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           R F +L   L PG  L     P+FPR+
Sbjct: 484 RQFAALGTALVPGTELPAP-APVFPRY 509


>gi|325676285|ref|ZP_08155964.1| methionine--tRNA ligase [Rhodococcus equi ATCC 33707]
 gi|325552846|gb|EGD22529.1| methionine--tRNA ligase [Rhodococcus equi ATCC 33707]
          Length = 528

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 355/510 (69%), Gaps = 2/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +R   Y++TAIAYPN  PHIGHAYE I +D +ARF RLDG DV F TGTDEHG K+ + A
Sbjct: 15  DRPPFYLTTAIAYPNGVPHIGHAYEYISSDAIARFKRLDGFDVFFLTGTDEHGLKMQQTA 74

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
              GV  +    +NS  F+ M   L+ISYD FIRTT+  H +  + +W+++   GDIY  
Sbjct: 75  AKEGVDVRDLATRNSDVFQAMDKALNISYDRFIRTTDADHLEASKAIWERMVAAGDIYLD 134

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYE 181
            YSGWYS+RDEA++ ++E     DG     +   PV+W EE  Y FRLS YQD+LL++YE
Sbjct: 135 TYSGWYSVRDEAFHAEEETTVLEDGTRLATETGTPVEWTEESNYTFRLSKYQDRLLAHYE 194

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            +P+FI P  RRNE++SFVKSGLKDLS+SR TFDWG+ +P DP ++MYVW+DALTNYLT 
Sbjct: 195 ENPDFIAPATRRNEILSFVKSGLKDLSISRTTFDWGVPVPGDPAHVMYVWVDALTNYLTG 254

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            G+ +       ++WPA+LH+IGKDI RFH +YWPAFL+SA + LPK+VF HGF+ +KGE
Sbjct: 255 AGFPNTDSAEFERYWPANLHIIGKDITRFHTVYWPAFLMSAGIELPKRVFVHGFLFNKGE 314

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS+GNV+DP+ ++E+ G+DA+R+FL+REI+ G+DG Y  + +  R+N DLAN +GNL
Sbjct: 315 KMSKSVGNVVDPLAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRMNTDLANELGNL 374

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS+SM+ K+ D  +PTPG  T++D ++L+    +L+++R     Q +H  L  +  ++
Sbjct: 375 AQRSLSMVAKNCDAQVPTPGELTDADRALLAQADALLEKVRAEFDVQALHLGLEAIWHVL 434

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            E +RYF  Q+PW L+KT+P R +TVLYVT+EV+R + IL+Q  +P  A KI D+L  A 
Sbjct: 435 GETNRYFSQQEPWVLRKTDPARMATVLYVTLEVVRIVGILVQPVMPGSAEKILDLLGQAP 494

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           + R F  L  R+  G  L K    +FPR++
Sbjct: 495 DARAFVDLANRIVAGTPLPKPVG-VFPRYV 523


>gi|312115063|ref|YP_004012659.1| methionyl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220192|gb|ADP71560.1| methionyl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 523

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/513 (49%), Positives = 354/513 (69%), Gaps = 3/513 (0%)

Query: 1   MKEREKLY--ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKI 58
           M E++K +  I+TAI+YPN +PHIGHAYE +  D +ARF RLDG  V F TG DEHG K+
Sbjct: 1   MTEQQKPHYTITTAISYPNGEPHIGHAYEAVATDAMARFKRLDGHPVFFLTGVDEHGLKM 60

Query: 59  AKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGD 118
            + A   G+T     D+N+  F +M + LD+SYDDFIRTTE RHH++   +W+++   GD
Sbjct: 61  KQTAAKEGITPTELADRNTAKFIEMLEQLDVSYDDFIRTTEPRHHESVAEIWRRMEKAGD 120

Query: 119 IYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLS 178
           IY   Y GWYS+RDEA+Y + E   G +G     Q  PV+W EE+ YFFRLS Y+ KLL 
Sbjct: 121 IYLAGYKGWYSVRDEAFYAESETVLGGNGIRLGPQGTPVEWTEEQTYFFRLSKYEKKLLK 180

Query: 179 YYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           +YE +P FI+P ERRNEV+SFVK GL+DLS+SR T DWGI +PD P +I+YVW+DALTNY
Sbjct: 181 FYEENPGFIMPAERRNEVVSFVKGGLQDLSISRTTLDWGIPVPDAPGHIIYVWVDALTNY 240

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T  G+      +  + WPA +H+IGKDI RFHA+YWPAFL+SA LPLP++VF HGF+ +
Sbjct: 241 ITAAGFPKIRSKAWKERWPAQVHIIGKDITRFHAVYWPAFLMSAKLPLPERVFGHGFLYN 300

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           +GEK+SKS+GNV+ P ++++  GVD +RY+ +RE+  G+DG    + +  R+NADLAN +
Sbjct: 301 RGEKMSKSVGNVVAPKDLVDAYGVDQVRYYFLREVPFGQDGNITHEQMVNRINADLANDL 360

Query: 359 GNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           GNL  RS+SMI K+  G IP P     +DE IL+  + +L+  RE +  Q  H+AL  + 
Sbjct: 361 GNLAQRSLSMIAKNCAGTIPEPSETDAADEPILAASAALLEANREAIDQQAPHKALDAIW 420

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
            +V++ ++YF  Q+PW LKKTNP R  TVL+ T EV+R++AIL Q ++P  + K+ D L 
Sbjct: 421 KVVADTNKYFAVQEPWALKKTNPARMGTVLWTTAEVVRRVAILAQPYMPSSSAKLLDQLG 480

Query: 479 VADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           VA E+R F +L   LK G  +  T   +FPR++
Sbjct: 481 VAAEDRSFDALAHTLKAGTKI-ATPQGVFPRYV 512


>gi|254820391|ref|ZP_05225392.1| methionyl-tRNA synthetase [Mycobacterium intracellulare ATCC 13950]
          Length = 514

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 355/508 (69%), Gaps = 6/508 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAI YPN  PHIGHAYE +  D +ARF RLDG DV F TGTDEHG K+ + A   G+
Sbjct: 5   YVTTAITYPNGDPHIGHAYEYVATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEGI 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ + + L+IS+D FIRTT+  HH+  + +W++++  GDIY   YSGW
Sbjct: 65  GTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKEIWRRMAAAGDIYLDTYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+RDE ++ + E     DG     +   PV W EE+ YFFRLSAY DKLL++YE++P+F
Sbjct: 125 YSVRDERFFVESETRLLDDGTRVAVETGAPVTWTEEQTYFFRLSAYADKLLAHYEANPDF 184

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFV  GL+DLS+SR +FDWG+++P+ P ++MYVW+DALTNYLT  GY D
Sbjct: 185 IAPEVRRNEVVSFVAGGLRDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGVGYPD 244

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                  ++WPADLH+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+L++GEK+SKS
Sbjct: 245 TDSEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSKS 304

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP+ +IEE GVD +RYFL+RE+  G+DG + ++ +  R+N DLAN +GNL  RS+
Sbjct: 305 VGNVVDPVALIEEFGVDQVRYFLLREVPFGQDGSFSEEAIITRINTDLANELGNLAQRSL 364

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K+  G++P PG FT +D  +L+    +L+ +R + ++Q +H AL  +  ++ E +R
Sbjct: 365 SMIAKNLGGVLPEPGEFTAADTELLATADGLLERLRASFESQAMHLALEAIWLMLGEANR 424

Query: 427 YFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           YF AQ+PW L+K+  +    R  TVLYVT E +R  A+L+Q  +P+ A  + D+L  A +
Sbjct: 425 YFSAQQPWVLRKSESEADQQRFRTVLYVTCEAVRIAALLVQPVMPESAGTLLDLLGQAQD 484

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F +L  RL PG +L      +FPR+
Sbjct: 485 QRTFAALGARLTPGTVLPPPTG-VFPRY 511


>gi|184200670|ref|YP_001854877.1| methionyl-tRNA synthetase [Kocuria rhizophila DC2201]
 gi|183580900|dbj|BAG29371.1| methionyl-tRNA synthetase [Kocuria rhizophila DC2201]
          Length = 517

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/512 (50%), Positives = 348/512 (67%), Gaps = 5/512 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   Y +TAI+YPN  PHIGHAYE I AD L RF RLDG+   F TGTDEHGQK+ +
Sbjct: 1   MTEQTPFYATTAISYPNGAPHIGHAYEAIAADTLVRFQRLDGVATRFQTGTDEHGQKMQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G T +   D NS  FR+M D L ISYD FIRTT++ H    + LWK++   GDIY
Sbjct: 61  TAEKLGTTPRELADANSARFREMDDELGISYDRFIRTTDEDHAAASQELWKRMEANGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
              Y+GWYS+RDEAYY +DE    ADGQ Y+      + W EEE YFFRLS YQD+LL  
Sbjct: 121 LDTYAGWYSVRDEAYYAEDETEVRADGQRYSIGTGTELTWTEEESYFFRLSRYQDRLLEL 180

Query: 180 YESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           Y +  +F+ P  R +E+ SFV  GL+DLS+SR TFDWG+ +P +P ++MYVW+DALTNYL
Sbjct: 181 YRT--DFVQPETRSHEIASFVGGGLQDLSISRTTFDWGVPVPGNPDHVMYVWVDALTNYL 238

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T  G+ D       +FWPA +H+IGKDI RFHA+YWPAFL+SA + LP+KVF+HGF+ ++
Sbjct: 239 TGLGFPDTDAPLFREFWPASVHLIGKDIARFHAVYWPAFLMSAGIELPRKVFAHGFLFNQ 298

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           GEK+SKS+GNVIDP  ++EE G+D LR+FL+RE+  G+DG Y  D +  R+N+DLAN +G
Sbjct: 299 GEKMSKSVGNVIDPHAMVEEYGLDQLRFFLLREVPFGQDGNYSHDAIAGRINSDLANDLG 358

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NL  RS+SM+ K+  G +P PG FT  D ++L+    V+ E R   +    HR L  V  
Sbjct: 359 NLAQRSLSMVAKNLGGEVPEPGEFTAEDLAMLAQAEDVVAEYRSAFEALAFHRGLESVWR 418

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +++  +RYF AQ+PW L+KT+P+R +TVLYVT EV+R +A+L+Q  +P    ++ + L  
Sbjct: 419 VIASANRYFTAQEPWVLRKTDPERMATVLYVTAEVLRIVAVLVQPVMPGSMARLLEQLGQ 478

Query: 480 AD-ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            + E R F +L  RL PG +L K    +FPR+
Sbjct: 479 PEGEARMFSALGTRLAPGTVLPKP-SGVFPRY 509


>gi|317506073|ref|ZP_07963901.1| tRNA synthetase class I [Segniliparus rugosus ATCC BAA-974]
 gi|316255645|gb|EFV14887.1| tRNA synthetase class I [Segniliparus rugosus ATCC BAA-974]
          Length = 514

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/508 (50%), Positives = 342/508 (67%), Gaps = 4/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   YI+TAI Y N  PH GHAYE I AD LARF RLDG +V F+ G DE+G K+ ++A+
Sbjct: 3   RTPYYITTAITYANGTPHFGHAYEFISADALARFARLDGKEVFFSMGMDEYGLKVQQSAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GV+ + FVD+ +  FR++   L  SYD FIRTTE  H    + LW+++S  GD+Y+G 
Sbjct: 63  KEGVSPQAFVDRVAERFRELHAALGSSYDRFIRTTEPAHAKASQELWRRMSANGDVYEGR 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+RDEA+Y ++E   G DG +       PV W EE  YFFRLSAYQD+LL  Y+ 
Sbjct: 123 YAGWYSVRDEAFYGEEETQLGEDGVRIAIPTGTPVAWTEESTYFFRLSAYQDRLLQLYQE 182

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           HPEFI P  RRNE++SFV  GLKDLS+SR +F+WG+ +PD P ++MYVW+DALTNYLT  
Sbjct: 183 HPEFIGPESRRNEIVSFVSQGLKDLSISRSSFNWGVPVPDSPGHVMYVWVDALTNYLTAI 242

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+ D+   + AKFWPADL +IGKDI RFHA+YWPAFLLSA    PK+VF HGF+L+KG+K
Sbjct: 243 GFPDD-TANVAKFWPADLEIIGKDITRFHAVYWPAFLLSAGFEPPKRVFGHGFVLNKGQK 301

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS G  +DP  ++E  G DA+R+F +REI  G+DG Y  + +  R NADL+NG+GNL 
Sbjct: 302 MSKSAGTGLDPFWLVETFGQDAVRFFALREIPYGQDGSYSDEAIVTRANADLSNGLGNLA 361

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R ++MI K++ G +P P AF+  DE++L     +L E R + + Q    ALA V  LVS
Sbjct: 362 QRCLTMIAKNFGGAVPRPAAFSAEDEALLGRADALLAEYRPHFEAQRPDLALAAVFDLVS 421

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + + YF AQ PW LK+ + DR  +VLYVT EV+RQ AILLQ  +P+   K+ D+L     
Sbjct: 422 QANGYFTAQAPWTLKE-DLDRMGSVLYVTAEVVRQAAILLQPAMPQATEKLLDLLGQEAA 480

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F  L  R+ PG  L +    +FPR 
Sbjct: 481 ARSFADLASRISPGLALPEP-HAVFPRL 507


>gi|255327092|ref|ZP_05368168.1| methionine--tRNA ligase [Rothia mucilaginosa ATCC 25296]
 gi|255296309|gb|EET75650.1| methionine--tRNA ligase [Rothia mucilaginosa ATCC 25296]
          Length = 514

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/507 (51%), Positives = 354/507 (69%), Gaps = 6/507 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI+YPN  PHIGHAYE I ADVLARF RLDG DV F TGTDEHGQK+   A+  G
Sbjct: 6   FYITTAISYPNGNPHIGHAYETIAADVLARFKRLDGFDVRFMTGTDEHGQKMQTTAEKLG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T K   D+NS  F+ M D L+ISYD FIRTT+  H+   + +WK++ + GDIY   Y+G
Sbjct: 66  KTAKELADENSARFKAMNDALNISYDRFIRTTDPDHYVASQAIWKRMEENGDIYLDKYAG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEAYY +DE  +  DGQ Y       V+W EEE YFFRLS Y DKLL  Y ++  
Sbjct: 126 WYSVRDEAYYAEDET-EVRDGQRYAITTGTEVEWTEEESYFFRLSKYGDKLLELY-ANEG 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           ++ P  RRNE+ISFVK GL DLS+SR TFDWG+ +P + +++MYVW+DALTNYLT  GY 
Sbjct: 184 YVYPESRRNELISFVKGGLNDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTGLGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  +    K+WPADLH+IGKDI RFH+IYWPAFL SA + LPK+VF HGF+L  GEK+SK
Sbjct: 244 DTDNELFTKYWPADLHLIGKDITRFHSIYWPAFLWSAGVELPKRVFGHGFLLVNGEKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GNV+DP  +++  G+DA+R+FL+RE++ G+DG Y ++ +  R+N+DLAN +GNL  RS
Sbjct: 304 SVGNVVDPANLVDAFGLDAVRFFLMREVSFGQDGSYSEESIINRINSDLANNLGNLAQRS 363

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SM+ K+  G +PT G FTE+D  IL   + + + +R +   Q  HRAL ++ +++++ +
Sbjct: 364 LSMVAKNCGGAVPTHGEFTEADRQILDQAAALYEPVRADFDEQAFHRALERIWTVLADTN 423

Query: 426 RYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-EN 483
            YF  Q+PW L+K    DR +TVLYVT+EV+RQ+A+LLQ  +P    K+  +L V + + 
Sbjct: 424 AYFAEQEPWTLRKNGELDRMNTVLYVTLEVVRQVALLLQPVMPDSTAKLLTLLGVPEGDA 483

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           R F +L   L PG  L     P+FPR+
Sbjct: 484 RQFAALGTALVPGTELPAP-APVFPRY 509


>gi|312138647|ref|YP_004005983.1| methionine-tRNA ligase metg [Rhodococcus equi 103S]
 gi|311887986|emb|CBH47298.1| methionine-tRNA ligase MetG [Rhodococcus equi 103S]
          Length = 528

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/510 (49%), Positives = 354/510 (69%), Gaps = 2/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +R   Y++TAIAYPN  PHIGHAYE I +D +ARF RLDG +V F TGTDEHG K+ + A
Sbjct: 15  DRPPFYLTTAIAYPNGVPHIGHAYEYISSDAIARFKRLDGFEVFFLTGTDEHGLKMQQTA 74

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
              GV  +    +NS  F+ M   L+ISYD FIRTT+  H +  + +W+++   GDIY  
Sbjct: 75  AKEGVDVRDLATRNSDVFQAMDKALNISYDRFIRTTDADHLEASKAIWERMVAAGDIYLD 134

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYE 181
            YSGWYS+RDEA++ ++E     DG     +   PV+W EE  Y FRLS YQD+LL++YE
Sbjct: 135 TYSGWYSVRDEAFHAEEETTVLEDGTRIATETGTPVEWTEESNYTFRLSKYQDRLLAHYE 194

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            +P+FI P  RRNE++SFVKSGLKDLS+SR TFDWG+ +P DP ++MYVW+DALTNYLT 
Sbjct: 195 ENPDFIAPATRRNEILSFVKSGLKDLSISRTTFDWGVPVPGDPAHVMYVWVDALTNYLTG 254

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            G+ +       ++WPA+LH+IGKDI RFH +YWPAFL+SA + LPK+VF HGF+ +KGE
Sbjct: 255 AGFPNTDSAEFERYWPANLHIIGKDITRFHTVYWPAFLMSAGIELPKRVFVHGFLFNKGE 314

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS+GNV+DP+ ++E+ G+DA+R+FL+REI+ G+DG Y  + +  R+N DLAN +GNL
Sbjct: 315 KMSKSVGNVVDPLAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRMNTDLANELGNL 374

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS+SM+ K+ D  +PTPG  T++D ++L+    +L ++R     Q +H  L  +  ++
Sbjct: 375 AQRSLSMVAKNCDAQVPTPGELTDADRALLAQADALLGKVRAEFDVQALHLGLEAIWHVL 434

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            E +RYF  Q+PW L+KT+P R +TVLYVT+EV+R + IL+Q  +P  A KI D+L  A 
Sbjct: 435 GETNRYFSQQEPWVLRKTDPARMATVLYVTLEVVRIVGILVQPVMPGSAEKILDLLGQAP 494

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           + R F  L  R+  G  L K    +FPR++
Sbjct: 495 DARAFVDLANRIVAGTPLPKPVG-VFPRYV 523


>gi|83311547|ref|YP_421811.1| methionyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|82946388|dbj|BAE51252.1| Methionyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 516

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/513 (50%), Positives = 348/513 (67%), Gaps = 4/513 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M      Y++T I Y N +PHIGHAY  +  DVLARF RLDG DV F TGTDEHGQK+ K
Sbjct: 1   MTGAGTFYVTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           +A+  GVT +   DQNS NFR++A +L  + DDFIRTTE RH   C+ LW K+  KGDIY
Sbjct: 61  SAEAFGVTPQALADQNSANFRELAKILGCTNDDFIRTTEARHKAACQALWDKLVAKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
            G Y GWYS+RDEA+Y +DE+ KGADG        PV+W++E  YFFRLSA+QD+LL +Y
Sbjct: 121 LGAYEGWYSVRDEAFYAEDELVKGADGAKLAPTGAPVEWVKEPSYFFRLSAWQDRLLRWY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+ + P  RRNEV+SFVK GL+DLS+SR +F WGI +P D  +IMYVW+DALTNY+T
Sbjct: 181 EDNPDCVAPQSRRNEVMSFVKGGLQDLSVSRTSFKWGIPVPGDDAHIMYVWLDALTNYIT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D   G  A++WP  +H++GKDI+RFHA+YWPAFL++A+LP PK+VF+HG+  ++G
Sbjct: 241 AVGYPDT-TGDFARYWPNVIHMVGKDIVRFHAVYWPAFLMAADLPAPKRVFAHGWWTNEG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           +KISKS+GNVIDP+ +IE  G+D +RYFL+RE+  G DG +    +  R+N++LAN  GN
Sbjct: 300 QKISKSVGNVIDPLSLIETYGLDQVRYFLLREVPFGNDGDFSHRAMMGRMNSELANDYGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           LV RS+SMI K+  G+ P     T+ D+ +L     +L ++R+ M  QL H A+  +  +
Sbjct: 360 LVQRSLSMIGKNCGGVTPAHLPDTDEDKEMLGAAYGMLAKVRDAMDRQLYHEAIEAIWVV 419

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V   + Y D Q PW LKKT+P R  TVL+V  E IR LA+L Q F+P  + +I D L V 
Sbjct: 420 VRAANAYVDKQAPWALKKTDPARMGTVLWVLAETIRCLALLTQPFMPAASARILDQLMVP 479

Query: 481 DENRCFQ--SLDQRLKPGFMLHKTFDPIFPRFL 511
           +  R F        LK G  L  T   +FPR++
Sbjct: 480 EAERSFAFFGPGHALKAGISL-PTPQGVFPRYV 511


>gi|319408565|emb|CBI82218.1| Methionyl-tRNA synthetase [Bartonella schoenbuchensis R1]
          Length = 519

 Score =  545 bits (1403), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 355/510 (69%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YPN  PHIGHAY  I +D LARF RLDG DV F +GTDEHG K+ +AA+
Sbjct: 2   RDTYYITTPIFYPNGAPHIGHAYNAIASDSLARFQRLDGKDVFFLSGTDEHGLKMQQAAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +T +   D+NS  F+ M   L+ S DDFIRTTE+RHH TC+ +WKK+   GDIY   
Sbjct: 62  ALNITPQQLADRNSAIFQKMLTKLNCSNDDFIRTTEERHHRTCQAIWKKMEANGDIYLDR 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+R E+YY + +   G DG     +  +PV+W EEE YFF+LS Y+  LL +YE 
Sbjct: 122 YAGWYSVRQESYYEEKDTQIGEDGIRREKELGSPVEWNEEESYFFKLSRYEKALLEHYEK 181

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +P+FI P ERRNE+ISF+KSGLKD+S+SR  F+WG+ +P++ +++MYVW+DALTNYLT  
Sbjct: 182 YPDFIAPNERRNEIISFIKSGLKDISISRTNFNWGVGVPNNSKHVMYVWVDALTNYLTAI 241

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
            +  N    K  FW A  H+IGKDI+RFHAIYWPAFL+SA + LPK++F+HGF+L++G K
Sbjct: 242 DFF-NEISKKRHFWSASTHIIGKDIIRFHAIYWPAFLMSAGIELPKRIFAHGFLLNRGAK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS+GNV+DP E+I+  G+D +RYF +RE+  G+DG Y+ +    R+ ADL N +GNL 
Sbjct: 301 MSKSVGNVVDPFEIIDRYGLDQVRYFFLREVPFGQDGSYNHESFVNRITADLVNDLGNLA 360

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SMI K+ D  IP P  F   DE +L    +V++  R+ M  Q  H AL+ + S+V+
Sbjct: 361 QRSLSMIQKNCDAKIPAPTDFLAQDEQLLEQSLQVIEVARQAMSRQAPHLALSAIFSVVA 420

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + +RYF +++PW L K+NP+R  TVLYVT+EV+R++ I+L  F+P+ A K+ D L +A E
Sbjct: 421 DANRYFASEEPWSLCKSNPERFFTVLYVTLEVLRRIGIMLLPFIPQSAAKLLDSLAIAKE 480

Query: 483 NRCFQSL-DQRLKPGFMLHKTFDPIFPRFL 511
           +R    + D ++K G  L     PIFPR++
Sbjct: 481 DRLLHHISDSKIKEGENLPLPV-PIFPRYV 509


>gi|118469128|ref|YP_889680.1| methionyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]
 gi|118170415|gb|ABK71311.1| methionyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155]
          Length = 515

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/511 (49%), Positives = 356/511 (69%), Gaps = 6/511 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAIAYPN  PHIGHAYE I  D +ARF RLDG DV + TGTD HGQK+A+ A  
Sbjct: 3   EPFYITTAIAYPNGVPHIGHAYEYIATDAIARFKRLDGYDVRYLTGTDVHGQKMAETAAK 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+       +NS  F+ + + L+IS+D FIRT++  H++  + +WK+++D GDIY   Y
Sbjct: 63  EGIPAAELARRNSDVFQRLQEKLNISFDRFIRTSDADHYEASKAIWKRMADAGDIYLDAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESH 183
            GWYS+RDE ++ ++E  +  DG     +   PV W EE+ YFFRLSAY D+LL+ YE H
Sbjct: 123 KGWYSIRDERFFTENETTEQPDGTRIATETGAPVTWTEEQTYFFRLSAYTDRLLALYEEH 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNE++SFV  GLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT  G
Sbjct: 183 PEFIGPDARRNEIVSFVSGGLKDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D    S  ++WPADLH+IGKDI+RFH +YWPAFL+SA LPLPK++F+HG++L++GEK+
Sbjct: 243 FPDTESESFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGLPLPKRIFAHGWLLNRGEKM 302

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP+ +++  G+D +RYFL+RE+  G+DG Y++D +  RVNADLAN +GNL  
Sbjct: 303 SKSIGNVVDPVNLVDTFGLDQVRYFLLREVPFGQDGSYNEDAIIGRVNADLANELGNLAQ 362

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SM+ K+    +P PG FT+ D ++L+    +L+ +RE+     +H AL  + S++  
Sbjct: 363 RSLSMVAKNLGAAVPDPGEFTDEDTALLAAADALLERVREHFDVPAMHLALEAIWSVLGA 422

Query: 424 VDRYFDAQKPWELKKTNP----DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
            +RYF AQ+PW L+K++      R  TVLY T+EV+R  ++LLQ  +P+   K+ D+L  
Sbjct: 423 ANRYFSAQEPWVLRKSDAAEDQQRFRTVLYTTLEVVRIASLLLQPVMPESTAKLLDLLGQ 482

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             + R F ++  R+KPG  L      IFPR+
Sbjct: 483 PTDERDFSAIANRIKPGTSLPAP-SGIFPRY 512


>gi|301598374|pdb|2X1L|A Chain A, Crystal Structure Of Mycobacterium Smegmatis
           Methionyl-Trna Synthetase In Complex With Methionine And
           Adenosine
 gi|301598375|pdb|2X1L|B Chain B, Crystal Structure Of Mycobacterium Smegmatis
           Methionyl-Trna Synthetase In Complex With Methionine And
           Adenosine
 gi|301598376|pdb|2X1L|C Chain C, Crystal Structure Of Mycobacterium Smegmatis
           Methionyl-Trna Synthetase In Complex With Methionine And
           Adenosine
 gi|301598377|pdb|2X1M|A Chain A, Crystal Structure Of Mycobacterium Smegmatis
           Methionyl-Trna Synthetase In Complex With Methionine
          Length = 524

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/511 (49%), Positives = 356/511 (69%), Gaps = 6/511 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAIAYPN  PHIGHAYE I  D +ARF RLDG DV + TGTD HGQK+A+ A  
Sbjct: 12  EPFYITTAIAYPNGVPHIGHAYEYIATDAIARFKRLDGYDVRYLTGTDVHGQKMAETAAK 71

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+       +NS  F+ + + L+IS+D FIRT++  H++  + +WK+++D GDIY   Y
Sbjct: 72  EGIPAAELARRNSDVFQRLQEKLNISFDRFIRTSDADHYEASKAIWKRMADAGDIYLDAY 131

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESH 183
            GWYS+RDE ++ ++E  +  DG     +   PV W EE+ YFFRLSAY D+LL+ YE H
Sbjct: 132 KGWYSIRDERFFTENETTEQPDGTRIATETGAPVTWTEEQTYFFRLSAYTDRLLALYEEH 191

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNE++SFV  GLKDLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT  G
Sbjct: 192 PEFIGPDARRNEIVSFVSGGLKDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVG 251

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D    S  ++WPADLH+IGKDI+RFH +YWPAFL+SA LPLPK++F+HG++L++GEK+
Sbjct: 252 FPDTESESFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGLPLPKRIFAHGWLLNRGEKM 311

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP+ +++  G+D +RYFL+RE+  G+DG Y++D +  RVNADLAN +GNL  
Sbjct: 312 SKSIGNVVDPVNLVDTFGLDQVRYFLLREVPFGQDGSYNEDAIIGRVNADLANELGNLAQ 371

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SM+ K+    +P PG FT+ D ++L+    +L+ +RE+     +H AL  + S++  
Sbjct: 372 RSLSMVAKNLGAAVPDPGEFTDEDTALLAAADALLERVREHFDVPAMHLALEAIWSVLGA 431

Query: 424 VDRYFDAQKPWELKKTNP----DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
            +RYF AQ+PW L+K++      R  TVLY T+EV+R  ++LLQ  +P+   K+ D+L  
Sbjct: 432 ANRYFSAQEPWVLRKSDAAEDQQRFRTVLYTTLEVVRIASLLLQPVMPESTAKLLDLLGQ 491

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             + R F ++  R+KPG  L      IFPR+
Sbjct: 492 PTDERDFSAIANRIKPGTSLPAP-SGIFPRY 521


>gi|262201453|ref|YP_003272661.1| methionyl-tRNA synthetase [Gordonia bronchialis DSM 43247]
 gi|262084800|gb|ACY20768.1| methionyl-tRNA synthetase [Gordonia bronchialis DSM 43247]
          Length = 523

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 345/506 (68%), Gaps = 5/506 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+TAIAYPN  PHIGHAYE I ADVLARFHRLDG DV F TGTD HGQK+ + A+  G+
Sbjct: 18  YITTAIAYPNGAPHIGHAYEYISADVLARFHRLDGYDVRFLTGTDVHGQKMQQTAEKEGI 77

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ + D L  SY  FIRT++  H      +W+++SD GDIY   YSGW
Sbjct: 78  PTAELARRNSDRFQALQDRLGSSYHRFIRTSDDDHKRASEAIWQRMSDNGDIYLDKYSGW 137

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPV-QWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           Y +RDE +Y D E      G+        V  W EEE YFFRLS YQDKLL  YES P+F
Sbjct: 138 YDVRDETFYADSETSVNEAGERVATDTGHVLTWTEEETYFFRLSNYQDKLLELYESDPDF 197

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFVK GL DLS+SR TFDWG+ +P  P ++MYVW+DALTNYLT  G+ D
Sbjct: 198 IGPDVRRNEVVSFVKGGLNDLSISRTTFDWGVPVPAHPDHVMYVWVDALTNYLTGAGFPD 257

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           + + +  ++WPADLH+IGKDI+RFH +YWPAFL+SA + LPK+VF HGF+L+KGEK+SKS
Sbjct: 258 D-EQTLRRYWPADLHIIGKDIIRFHCVYWPAFLMSAGIDLPKRVFVHGFLLNKGEKMSKS 316

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DP  +I E G+D +RYF +RE++ G+DG Y  D +  R+NADLAN  GNL  R++
Sbjct: 317 VGNVLDPDALIAEFGLDPVRYFFLREVSYGQDGSYSTDAIISRINADLANDFGNLAQRTL 376

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K +DG +P PG + ++D  +L+    +L  +R +++ Q IH AL  + S++ E +R
Sbjct: 377 SMIGKYFDGALPAPGVYLDADTELLARADALLDTVRAHIEVQAIHLALEAMWSVLGETNR 436

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN--R 484
           Y  AQ+PW+L KT+  R  TVLYV  EV+R +A+L Q  +P    K+ D+L V D    R
Sbjct: 437 YISAQEPWKLAKTDLGRTGTVLYVCAEVVRIVALLSQPVMPASTAKLLDLLGVDDSGAAR 496

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRF 510
            F ++  RL PG  L K   PIFPR+
Sbjct: 497 QFSAVTDRLAPGTTLPKP-TPIFPRY 521


>gi|118465949|ref|YP_880395.1| methionyl-tRNA synthetase [Mycobacterium avium 104]
 gi|118167236|gb|ABK68133.1| methionyl-tRNA synthetase [Mycobacterium avium 104]
          Length = 519

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 348/509 (68%), Gaps = 6/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAI YPN  PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+ + A   G
Sbjct: 4   FYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEG 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           + T     +NS  F+ + + L+IS+D FIRTT+  HH+  + +W+++   GDIY   YSG
Sbjct: 64  IGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDE ++ + E     DG    A+   P+ W EE+ YFFRLSAY DKLL++YE++P+
Sbjct: 124 WYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEV+SFV  GL+DLS+SR +FDWG+K+PD P ++MYVW+DALTNYLT  GY 
Sbjct: 184 FIAPEVRRNEVVSFVSGGLRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D       ++WPADLH+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+L++GEK+SK
Sbjct: 244 DTESEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GN++DPI +++  GVD LRYFL+RE+  G+DG Y KD +  R+N DLAN +GNL  RS
Sbjct: 304 SVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTKDAIITRINTDLANELGNLAQRS 363

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SMI K+   ++P PG FT  D  +L     +L  +R +  +Q +H  L  +  ++ E +
Sbjct: 364 LSMIAKNLHSVVPEPGDFTGDDRELLQTADGLLPRVRASFDSQAMHLGLEAIWLMLGEAN 423

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           +YF AQ+PW L+K+  +    R  TVLYVT EV+R  A+L+Q  +P  A K+ D+L    
Sbjct: 424 KYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPDSAGKLLDLLGQGQ 483

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + R F +L  RL PG +L      +FPR+
Sbjct: 484 DRRAFDALGARLAPGTVLPPPTG-VFPRY 511


>gi|41407070|ref|NP_959906.1| methionyl-tRNA synthetase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41395421|gb|AAS03289.1| MetS [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 519

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 250/509 (49%), Positives = 349/509 (68%), Gaps = 6/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAI YPN  PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+ + A   G
Sbjct: 4   FYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEG 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           + T     +NS  F+ + + L+IS+D FIRTT+  HH+  + +W+++   GDIY   YSG
Sbjct: 64  IGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDE ++ + E     DG    A+   P+ W EE+ YFFRLSAY DKLL++YE++P+
Sbjct: 124 WYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEV+SFV  GL+DLS+SR +FDWG+K+PD P ++MYVW+DALTNYLT  GY 
Sbjct: 184 FIAPEVRRNEVVSFVSGGLRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D       ++WPADLH+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+L++GEK+SK
Sbjct: 244 DTESEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GN++DPI +++  GVD LRYFL+RE+  G+DG Y +D +  R+N DLAN +GNL  RS
Sbjct: 304 SVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTEDAIITRINTDLANELGNLAQRS 363

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SMI K+   ++P PG FT  D  +L     +L  +R +  +Q +H  L  +  ++ E +
Sbjct: 364 LSMIAKNLHSVVPEPGDFTGDDRELLQTADGLLPRVRASFDSQAMHLGLEAIWLMLGEAN 423

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           +YF AQ+PW L+K+  +    R  TVLYVT EV+R  A+L+Q  +P+ A K+ D+L    
Sbjct: 424 KYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPESAGKLLDLLGQGQ 483

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + R F +L  RL PG +L      +FPR+
Sbjct: 484 DRRAFDALGARLAPGTVLPPPTG-VFPRY 511


>gi|254774038|ref|ZP_05215554.1| methionyl-tRNA synthetase [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 519

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 250/509 (49%), Positives = 349/509 (68%), Gaps = 6/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAI YPN  PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+ + A   G
Sbjct: 4   FYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEG 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           + T     +NS  F+ + + L+IS+D FIRTT+  HH+  + +W+++   GDIY   YSG
Sbjct: 64  IDTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDE ++ + E     DG    A+   P+ W EE+ YFFRLSAY DKLL++YE++P+
Sbjct: 124 WYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEV+SFV  GL+DLS+SR +FDWG+K+PD P ++MYVW+DALTNYLT  GY 
Sbjct: 184 FIAPEVRRNEVVSFVSGGLRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D       ++WPADLH+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+L++GEK+SK
Sbjct: 244 DTESEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GN++DPI +++  GVD LRYFL+RE+  G+DG Y +D +  R+N DLAN +GNL  RS
Sbjct: 304 SVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTEDAIITRINTDLANELGNLAQRS 363

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SMI K+   ++P PG FT  D  +L     +L  +R +  +Q +H  L  +  ++ E +
Sbjct: 364 LSMIAKNLHSVVPEPGDFTGDDRELLQTADGLLPRVRASSDSQAMHLGLEAIWLMLGEAN 423

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           +YF AQ+PW L+K+  +    R  TVLYVT EV+R  A+L+Q  +P+ A K+ D+L    
Sbjct: 424 KYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPESAGKLLDLLGQGQ 483

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + R F +L  RL PG +L      +FPR+
Sbjct: 484 DRRAFDALGARLAPGTVLPPPTG-VFPRY 511


>gi|308177197|ref|YP_003916603.1| methionine--tRNA ligase [Arthrobacter arilaitensis Re117]
 gi|307744660|emb|CBT75632.1| methionine--tRNA ligase [Arthrobacter arilaitensis Re117]
          Length = 516

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 254/510 (49%), Positives = 346/510 (67%), Gaps = 3/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +++  YI+TAI+YPN  PHIGHAYE++  DV+ARF RLDG DV F TGTDEHGQK+ + A
Sbjct: 4   QQKPFYITTAISYPNGTPHIGHAYEVVATDVMARFKRLDGYDVFFMTGTDEHGQKMMQTA 63

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +   +T      +NS  F+ M D L  SYD FIRTT+  HH   + LW+++    DIY  
Sbjct: 64  EKLEITPAQLAQRNSDAFQSMNDELGTSYDRFIRTTDADHHAAAQELWRRMEANDDIYLD 123

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYE 181
            Y+GWYS+RDEA+Y +++     DG  Y A+ +  V W EEE YFFRLS YQDKLL YY 
Sbjct: 124 KYAGWYSVRDEAFYTEEQTEVREDGIRYAAETDTEVTWTEEESYFFRLSKYQDKLLDYYR 183

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            +PEF  P  R NEV+ FV+SGL DLS+SR TFDWGI +P + +++MYVW+DALTNYLT 
Sbjct: 184 DNPEFGAPRSRFNEVVRFVESGLTDLSISRTTFDWGIPVPGNEKHVMYVWVDALTNYLTG 243

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            G+ D    S  K+WPAD+HVIGKDI RFHAIYWPAFL+SA LPLPK+V  HGF+ + G 
Sbjct: 244 VGFPDVDSASFKKYWPADVHVIGKDISRFHAIYWPAFLMSAKLPLPKRVMIHGFLHNNGV 303

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKSLGN + P + +   G+D +RYF +RE+  G DG Y+ + +  R+N DLAN  GNL
Sbjct: 304 KMSKSLGNTVSPDDFVNRYGLDQVRYFFLREVPFGADGNYNHETIVARINGDLANNFGNL 363

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS+SM+ K+  G++PTP   +E+D +IL    ++L+  RE    Q   +AL  V  ++
Sbjct: 364 AQRSLSMVAKNCGGVVPTPAELSEADNAILDAAGQLLEINREAYSRQEFSKALEAVWHVL 423

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            + + YF  Q+PW+LKKT+P+R +TVLYVT+E++R++A+LLQ  +P+    + + L V +
Sbjct: 424 GDTNAYFAEQEPWKLKKTDPERMATVLYVTIEIVRKVALLLQPVLPQAMTSMLNALAVGE 483

Query: 482 EN-RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            + R F+S D  L PG  L     P+FPR+
Sbjct: 484 GSARNFESFDSALVPGTEL-PVPSPVFPRY 512


>gi|296169876|ref|ZP_06851488.1| methionine--tRNA ligase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295895432|gb|EFG75134.1| methionine--tRNA ligase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 513

 Score =  538 bits (1386), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 247/508 (48%), Positives = 344/508 (67%), Gaps = 5/508 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAI YPN  PH+GHAYE +  D +ARF RLDG DV F TGTDEHG K+ + A   G
Sbjct: 4   FYVTTAITYPNGNPHVGHAYEYVATDAIARFKRLDGFDVRFLTGTDEHGLKMMETAAAEG 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           + T     +NS  F+ + + L+IS+D FIRTT+  HH+  + +W+++   GDIY   YSG
Sbjct: 64  IPTAELARRNSDVFQRLQEKLNISFDRFIRTTDPDHHEASQEIWRRMEAAGDIYLDSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDE ++ + E       +       PV W EE+ YFFRLSAY DKLL++Y+++PEF
Sbjct: 124 WYSVRDERFFVESETAVVEGTRVAVETGTPVTWTEEQTYFFRLSAYADKLLAHYDANPEF 183

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV+SFV  GL+DLS+SR +FDWG+K+P  P +++YVW+DALTNYLT  GY D
Sbjct: 184 IAPEVRRNEVVSFVSGGLRDLSISRTSFDWGVKVPGHPDHVVYVWVDALTNYLTGVGYPD 243

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                  ++WPADLH+IGKDI+RFH +YWPAFL+SA + LP++VF+HGF+L++GEK+SKS
Sbjct: 244 TDSELFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIDLPRRVFAHGFLLNRGEKMSKS 303

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GN++DP  +++  GVD LRYFL+RE+  G+DG Y +D +  R N DLAN +GNL  RS+
Sbjct: 304 VGNIVDPDALVDTFGVDQLRYFLLREVPFGQDGSYSEDAIVTRTNTDLANELGNLAQRSL 363

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+ DG++P PG FT  D  +L V   +L  +R    NQ +H AL  +  ++   +R
Sbjct: 364 SMVAKNLDGIVPAPGEFTAEDTELLDVADGLLDRVRIEFDNQAMHLALEAIWLMLGAANR 423

Query: 427 YFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           YF AQ+PW L+K+  +    R +TVLY T E +R  A+L+Q  +P+ A K+ D+L  A E
Sbjct: 424 YFSAQQPWVLRKSESEADRKRFATVLYTTCEAVRIAALLVQPVMPESAGKLLDLLGQAPE 483

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F ++  RL PG  L      +FPR+
Sbjct: 484 RRGFDAVATRLAPGTALPAPTG-VFPRY 510


>gi|116671079|ref|YP_832012.1| methionyl-tRNA synthetase [Arthrobacter sp. FB24]
 gi|116611188|gb|ABK03912.1| methionyl-tRNA synthetase [Arthrobacter sp. FB24]
          Length = 519

 Score =  538 bits (1385), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/506 (51%), Positives = 342/506 (67%), Gaps = 3/506 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI YPN  PHIGHAYE I  D +ARF RLDG DV F TGTDEHG KIA+ A   G
Sbjct: 9   FYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVFFLTGTDEHGMKIAQTADKEG 68

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K  VD+N+  ++     L ISYD FIRTT++ H+   + +WKK+   GDIY   Y G
Sbjct: 69  ITPKELVDRNAEIYKAAHAALGISYDRFIRTTDEDHYAASQAIWKKMEANGDIYLSKYEG 128

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WYS+RDEAYY +DE     DG  Y+ + +  + W  EE YFFRLSAYQDKLL+ YE+HPE
Sbjct: 129 WYSVRDEAYYVEDETVVKEDGLRYSRETDTELTWTAEESYFFRLSAYQDKLLALYEAHPE 188

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F  P  R NEVISFVK GL+DLS+SR TFDWG+ +P + +++MYVW+DALTNYLT  GY 
Sbjct: 189 FGAPQSRFNEVISFVKRGLEDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTGVGYP 248

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D    S  K+WPAD+HVIGKDI RFHAIYWPAFL+SA L LPK++  HGF+ + G K+SK
Sbjct: 249 DTESDSFKKYWPADVHVIGKDISRFHAIYWPAFLMSAGLELPKRIMIHGFLNNNGVKMSK 308

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV+ P + + + G+D +R+F +RE+  G DG Y  + +  R+N+DLAN  GNL  RS
Sbjct: 309 SLGNVVAPSDFVAQYGLDQVRFFFLREVPFGADGSYSHEAIVGRMNSDLANNFGNLAQRS 368

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SM+ K+ +G +P PGAFT  D ++L   + +L+  R   + Q   RAL  +  ++ + +
Sbjct: 369 LSMVAKNCEGRVPVPGAFTAEDSALLEQANGLLEAARAAFEKQEFSRALEAIWGVLGDTN 428

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-ENR 484
            YF  Q PW L+KT+ +R +TVLYVT+EV+R +AIL+Q  +PK +  + D L   D E R
Sbjct: 429 AYFAEQAPWVLRKTDVERMNTVLYVTLEVLRIVAILVQPVMPKASAALLDTLGQPDGEAR 488

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRF 510
            F ++   L PG  L     PIFP++
Sbjct: 489 RFAAIATPLVPGTELPAP-SPIFPKY 513


>gi|260905420|ref|ZP_05913742.1| methionyl-tRNA synthetase [Brevibacterium linens BL2]
          Length = 573

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/473 (52%), Positives = 341/473 (72%), Gaps = 3/473 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPN   HIGHAYE I AD +ARF RLD  +V F TGTDEHG K+ +AA   G+
Sbjct: 4   YLTTAIAYPNGAIHIGHAYEYIAADTIARFKRLDNHEVFFATGTDEHGLKMLQAANKLGI 63

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           + K   D N++NFRD    L  ++D FIRTT++ H++  + +W+K+ + GDIY   Y+GW
Sbjct: 64  SPKELADDNAKNFRDTQLALGSTFDRFIRTTDEDHYEASKAIWRKLEEAGDIYLDTYAGW 123

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+RDEA+Y  DE  +  DG   + +    V W EEE YFFRLS YQDKLL  Y++HPEF
Sbjct: 124 YSVRDEAFYTQDET-EVVDGVRLSTETRTEVTWTEEESYFFRLSNYQDKLLELYKNHPEF 182

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEV SFV SGLKDLS+SR TFDWG+ +P + +++MYVWIDALTNYLT  GY D
Sbjct: 183 IGPDSRRNEVASFVASGLKDLSVSRTTFDWGVPVPGNEKHVMYVWIDALTNYLTAAGYPD 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           + +    K+WPAD+H+IGKDI+RFH++YWPAFL+SA + LPK+V +HGF+ + GEK+SKS
Sbjct: 243 DQE-RLDKWWPADVHIIGKDIIRFHSVYWPAFLMSAGIELPKRVHAHGFLFNAGEKMSKS 301

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNV+DPI++++  G+D LR+FL RE + G DG Y KD +  R N+DLAN  GNL  RS+
Sbjct: 302 VGNVVDPIDLVDAFGLDTLRFFLFREFSYGNDGSYTKDSIITRKNSDLANEYGNLAQRSL 361

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SMI K+ D  +P PG  T+ DE++L++   V    R ++  Q +H  +     +++E +R
Sbjct: 362 SMIAKNCDAQVPQPGELTDDDEALLALARAVPDNARRHVDTQALHLYVEACWKVLTEANR 421

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           YF AQ+PW+LKKT+PDR +TVL+VT+EV+R ++IL+Q  +P+ A KI D+L V
Sbjct: 422 YFSAQEPWKLKKTDPDRMATVLWVTIEVVRIISILIQPVMPESAGKILDLLGV 474


>gi|288958659|ref|YP_003449000.1| methionyl-tRNA synthetase [Azospirillum sp. B510]
 gi|288910967|dbj|BAI72456.1| methionyl-tRNA synthetase [Azospirillum sp. B510]
          Length = 519

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/515 (49%), Positives = 351/515 (68%), Gaps = 8/515 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M   +  Y++T I Y N  PHIGHAY  +  DVLARF RLDG DV F TGTDEHGQK+ K
Sbjct: 4   MAGPKTFYLTTPIYYVNDVPHIGHAYTTLACDVLARFMRLDGYDVKFLTGTDEHGQKVEK 63

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           +A+ AG+  + F D+ SRNFRD+  +++ S DDFIRTTE RH  + + LW  + D+G+IY
Sbjct: 64  SAEKAGIAPQDFTDRVSRNFRDLVSLMNYSNDDFIRTTEPRHVKSVQALWTLLKDRGEIY 123

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
            G Y+GWYS+RDEA+Y +DE+    +G+         +W+EE  YFF+LSA+QD+L+ +Y
Sbjct: 124 LGSYAGWYSVRDEAFYGEDELTTNPEGKKIAPTGAECEWVEEPSYFFKLSAWQDRLIEFY 183

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P  +RNEV++FVKSGLKDLS+SR TF WGI +P D  +IMYVW+DAL NY+T
Sbjct: 184 ERNPDFIAPAGKRNEVMAFVKSGLKDLSVSRTTFKWGIPVPGDDAHIMYVWLDALANYIT 243

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D   G  AK+WPADLH++GKDILRFHA+YWPAFL++A L  PK+VF+HG+   +G
Sbjct: 244 AVGYPDT-TGDYAKYWPADLHMVGKDILRFHAVYWPAFLMAAGLQPPKRVFAHGWWTIEG 302

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           +K+SKSLGNVI P  ++   G+D  RYFL+RE+  G DG +    +  R+N +LAN  GN
Sbjct: 303 QKMSKSLGNVIAPETLVTTYGLDQTRYFLLREVPFGNDGDFSHKQMVNRINGNLANDYGN 362

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           LV R +SMI K+    +PTPGAFTE+D+++L     +L  +R  ++ Q  H+AL  + ++
Sbjct: 363 LVQRVLSMIGKNCAAAVPTPGAFTEADQALLGPAYGLLDVVRAEIRAQAFHKALDAIWAV 422

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V + +RY D Q PW LKKT+P R +TVLYV  E IR LAIL Q  +P  + +I D+L + 
Sbjct: 423 VGDANRYVDEQAPWALKKTDPARMATVLYVLAETIRHLAILTQPVMPDASARILDLLALG 482

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDP----IFPRFL 511
            + R F +L      G ++  T  P    +FPR++
Sbjct: 483 PDARGFGTLGPS---GALVAGTPLPTPQGVFPRYV 514


>gi|296394638|ref|YP_003659522.1| methionyl-tRNA synthetase [Segniliparus rotundus DSM 44985]
 gi|296181785|gb|ADG98691.1| methionyl-tRNA synthetase [Segniliparus rotundus DSM 44985]
          Length = 514

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 254/508 (50%), Positives = 339/508 (66%), Gaps = 4/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   Y++TAI Y N  PH GHAYE I AD  ARF RLDG DV F+ G DE+GQK+ ++A+
Sbjct: 3   RTPYYLTTAITYANGAPHFGHAYEFISADAFARFARLDGKDVFFSVGMDEYGQKVQQSAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ + FVD+ +  F ++   L  SYD FIRTTE  H  + + LW+++   GDIY+G 
Sbjct: 63  KEGISPQEFVDRVAERFLELHAALGSSYDRFIRTTEPGHTASVQELWRRMDANGDIYQGS 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+RDEA+Y ++E   G DG +  +A   PV W EE  YFFRLSAYQD+LL+ YE 
Sbjct: 123 YTGWYSVRDEAFYGEEETCVGEDGVRIASATGTPVAWTEESTYFFRLSAYQDRLLALYEE 182

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           HPEFI P  RRNE++ FV  GLKDLS+SR +F+WG+ +P DP+++MYVW+DALTNYLT  
Sbjct: 183 HPEFIGPDSRRNEIVRFVSQGLKDLSVSRSSFNWGVPVPGDPEHVMYVWVDALTNYLTAI 242

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+  +  G  AKFWPADL +IGKDI RFHA+YWPAFLLSA    PK+VF HGF+L+KG K
Sbjct: 243 GFPGDEAGV-AKFWPADLQIIGKDITRFHAVYWPAFLLSAGFAPPKRVFGHGFVLNKGHK 301

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS G  +DP  +IE  G DA+R+F +REI  G+DG Y  + +  R NA+L+NG+GNL 
Sbjct: 302 MSKSAGTGLDPFWLIETFGQDAVRFFALREIPYGQDGSYSDEAIVTRANAELSNGLGNLA 361

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R ++MI K++ G +P PGA    DE++L+    +L   R +   Q    A+A V  +VS
Sbjct: 362 QRCLTMIAKNFGGTVPDPGALAAEDEALLAQADGMLAAYRPHFAAQRPDLAIAAVFDVVS 421

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
             + YF AQ PW LK+ +  R  T+LY T EV+RQ AILLQ  +P+ + K+ D+L  +  
Sbjct: 422 LANGYFTAQAPWTLKE-DLGRMGTILYTTAEVVRQAAILLQPAMPQASEKLLDLLGQSSG 480

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F  L  RL PG  L +    +FPR 
Sbjct: 481 ARMFADLPARLAPGLALPEP-KAVFPRL 507


>gi|217976728|ref|YP_002360875.1| methionyl-tRNA synthetase [Methylocella silvestris BL2]
 gi|217502104|gb|ACK49513.1| methionyl-tRNA synthetase [Methylocella silvestris BL2]
          Length = 519

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 247/508 (48%), Positives = 346/508 (68%), Gaps = 6/508 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAI Y N  PHIGHAYE I  D +ARF RLDG + LF TG DEHGQK+ + A    
Sbjct: 6   FYITTAIPYANGAPHIGHAYERIATDAIARFKRLDGYETLFVTGMDEHGQKMQQTAAREN 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++     D+ +  F  M ++L+ S DD +RTTE RHH   + +WK++   GDIY   Y G
Sbjct: 66  LSPLQLADRTAAQFYAMGELLNASADDIVRTTEARHHAASQEIWKRMQASGDIYLSKYPG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEA+++D E+  G  G        PV+W+EEE Y+FRLSAYQ++LL+ Y   P+F
Sbjct: 126 WYSVRDEAFFDDSELTDGPGGSKLAPTGAPVEWVEEESYYFRLSAYQERLLALYRERPDF 185

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           + P + RNE+++FV+ GL DLS+SR TFDWG+ +P DP+++MYVW+DALTNY+T TG+ D
Sbjct: 186 VTPEKYRNEIVAFVERGLTDLSISRSTFDWGVPVPGDPKHVMYVWVDALTNYITGTGFPD 245

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                +AKFWPAD HVIGKDI RFHAIYWPAFL+SA L +PK++ +HGF+ ++GEK+SKS
Sbjct: 246 A-ASPRAKFWPADAHVIGKDITRFHAIYWPAFLMSAGLLVPKQIVTHGFLFNRGEKMSKS 304

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNVIDP  + +E GVD  RYFL+RE+  G+DG Y  + +  R NADLAN +GNL  RS+
Sbjct: 305 IGNVIDPFALAKEYGVDPFRYFLLREVPFGQDGNYSHEAIVNRTNADLANDLGNLAQRSL 364

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+  G++P+  A  E+DE++L     + Q+ R +M++  +H  LA++  +V E +R
Sbjct: 365 SMLAKNCGGVLPSSPALNETDEALLFQARALPQKARGHMRDYALHLILAEIWRVVGEANR 424

Query: 427 YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF 486
           YF  ++PW  +KT+P R  +VLYVTVEV+R +AI+ Q F+P    ++ D L VA + R F
Sbjct: 425 YFATEEPWVKRKTDPARMESVLYVTVEVLRIIAIMTQPFMPASMERLLDSLGVAKDARSF 484

Query: 487 QSLDQ---RLKPGFMLHKTFDPIFPRFL 511
              +    R   G +   T  P+FPR++
Sbjct: 485 ADAENFILRAPSGPLPAPT--PVFPRYV 510


>gi|294083928|ref|YP_003550685.1| methionyl-tRNA synthetase, class Ia [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663500|gb|ADE38601.1| Methionyl-tRNA synthetase, class Ia [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 516

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/514 (50%), Positives = 358/514 (69%), Gaps = 13/514 (2%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +K YI+T I Y N +PHIGHAY  +  DV+ARF RLDG +V F TGTDEHGQK+ KAAQ 
Sbjct: 4   KKFYITTPIYYVNDKPHIGHAYTTLACDVMARFKRLDGFEVKFLTGTDEHGQKVEKAAQV 63

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AG + + F +  S+NFRD+   L+ S DDFIRTTE+RH   C+ LW+ + DKG I    Y
Sbjct: 64  AGTSPQEFTNAVSQNFRDLTTQLNFSNDDFIRTTEERHKLACQQLWRILLDKGYIRLDTY 123

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           +GWY++RDEA+Y  DE+  G           PV+W+EE  YFF LS +QDKLL++YE++P
Sbjct: 124 AGWYAVRDEAFYTKDEIVDGK-----APSGAPVEWVEEPSYFFDLSKFQDKLLAFYEANP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +F+ P  R NEV SFVK GL+DLS+SR +F WG+ +PDD  ++MYVW+DALTNY+T TG+
Sbjct: 179 DFVAPASRFNEVKSFVKGGLRDLSVSRASFKWGVPVPDDDAHVMYVWLDALTNYITATGW 238

Query: 245 -LDNPDGSKA---KFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
            +D   G+     K WPADLH++GKDILRFHA+YWPAFL++A+LPLPK+VF+HG+  ++G
Sbjct: 239 PVDGAFGNAETYEKLWPADLHMVGKDILRFHAVYWPAFLMAADLPLPKRVFAHGWWTNEG 298

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           +KISKSLGNVIDP+ + E  G+D  RYFL+RE+  GKDG +    + +R+N+DLAN +GN
Sbjct: 299 QKISKSLGNVIDPVALSEIYGLDQTRYFLMREVPFGKDGDFSVQAMIQRMNSDLANDLGN 358

Query: 361 LVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           L  R +SMI K+ +G++P  P + +  D +IL+ C  +L ++R ++  Q  H AL  +  
Sbjct: 359 LSQRVISMIFKNCEGVMPALPVSPSPEDNAILTACDALLDQVRIHIDQQSFHEALRSIWD 418

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +++  +RY D+Q PW LKKT+P R   VL V  E+IRQ AIL Q F+P+   KI D L V
Sbjct: 419 VIAAANRYVDSQAPWGLKKTDPARMQEVLAVLAEIIRQFAILTQPFMPQSTAKILDQLGV 478

Query: 480 ADENRCFQSL--DQRLKPGFMLHKTFDPIFPRFL 511
            ++ R F +L    RL  G ++ K  +P+FPRF+
Sbjct: 479 DEKARGFDTLAGQVRLATGHVIGKP-EPVFPRFV 511


>gi|240169909|ref|ZP_04748568.1| methionyl-tRNA synthetase [Mycobacterium kansasii ATCC 12478]
          Length = 516

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 252/514 (49%), Positives = 351/514 (68%), Gaps = 5/514 (0%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           MK  +  Y++TAIAYPNA PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+A+
Sbjct: 1   MKPLQPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKVAQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA  AGV T     +NS  F+ M + L+IS+D FIRTT+  H+   + +W+++   GD+Y
Sbjct: 61  AAAAAGVPTAQLARRNSDVFQRMQEALNISFDRFIRTTDPDHYAASQEIWRRMEAAGDLY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDE ++ + E       +       PV W EE+ YFFRLSAY DKLL++Y
Sbjct: 121 LDNYSGWYSVRDERFFVESETQLVDGTRIAIETGTPVTWTEEQTYFFRLSAYADKLLAHY 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
            +HP+FI P  RRNEVISFV  GLKDLS+SR +F+WG+ +P+ P ++MYVW+DALTNYLT
Sbjct: 181 HAHPDFIAPEVRRNEVISFVSGGLKDLSVSRTSFNWGVPVPEHPDHVMYVWVDALTNYLT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D    S  ++WPADLH+IGKDI+RFHA+YWPAFL+SA + LP+KVF+HGF+ ++G
Sbjct: 241 GAGYPDTGSESFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRKVFAHGFLHNRG 300

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           EK+SKS+GNVIDP+ +I+  GVD +RYFL+RE+  G+DG Y  + +  R+N DLAN +GN
Sbjct: 301 EKMSKSVGNVIDPVALIQAYGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGN 360

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SM+ K+  G++P PG F ++D  +L+    +L  +R +   Q +H AL  +  +
Sbjct: 361 LAQRSLSMVAKNLGGVVPEPGEFCDADTELLATADGLLDRVRAHFDRQAMHLALEAIWLM 420

Query: 421 VSEVDRYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
           + + ++YF  Q+PW L+K+  +    R  T LY T EV+R  A+L+Q  +P+ A K+ D+
Sbjct: 421 LGDANKYFSTQQPWVLRKSESEADQARFRTTLYTTCEVVRIAALLVQPVMPESAAKMLDL 480

Query: 477 LFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           L   D+ R F ++  RL PG  L      +FPR+
Sbjct: 481 LGQPDDRRAFSAVGTRLAPGTQLPPPTG-VFPRY 513


>gi|221229512|ref|YP_002502928.1| methionyl-tRNA synthetase [Mycobacterium leprae Br4923]
 gi|219932619|emb|CAR70331.1| putative methionyl-tRNA synthase [Mycobacterium leprae Br4923]
          Length = 537

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/509 (49%), Positives = 355/509 (69%), Gaps = 7/509 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+TAIAYPNA PHIGHAYE I  D +ARF RLDGLDV F TGTDEHG K+A+AA+ AGV
Sbjct: 5   YITTAIAYPNAAPHIGHAYEYIATDAIARFKRLDGLDVRFLTGTDEHGLKVAQAAEAAGV 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L IS+D FIRTT+  H+   + +W+++   GDIY G YSGW
Sbjct: 65  PTAQLARRNSGVFQRMQEALHISFDRFIRTTDADHYKAAKEIWRRMDAAGDIYLGTYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWME-EEGYFFRLSAYQDKLLSYYESHPE 185
           YS+RDE ++ D E     +G     +   PV W E E+ YFFRLSAY DKLL++Y+++P+
Sbjct: 125 YSVRDERFFVDSETKLLDNGIRVAVETGTPVTWTEKEQTYFFRLSAYVDKLLAHYDANPD 184

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEVISFV  GL+D S+SR +FDWG+++P+ P ++MYVWIDALTNYLT  G+ 
Sbjct: 185 FIGPEVRRNEVISFVSGGLEDFSISRTSFDWGVQVPEHPDHVMYVWIDALTNYLTGAGFP 244

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D       ++WPA+LH+IGKDI+RFHA+YWPAFL+SA + LP+++F+HGF+ + GEK+SK
Sbjct: 245 DTDSELFGRYWPANLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNHGEKMSK 304

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GN++DP+ +++  GVD +RYFL+REI  G+DG Y ++ +  R+N DLAN  GNL  RS
Sbjct: 305 SVGNIVDPMALVQTFGVDQVRYFLLREIPFGQDGNYSEEAIITRMNTDLANEFGNLAQRS 364

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SM+ K+  G++P P  FT +D ++L+    +L+ +R N   Q ++ AL  +  ++ E +
Sbjct: 365 LSMVAKNLGGVVPEPSEFTSADTALLTTADGLLERVRGNFDGQAMNLALEAIWLMLGEAN 424

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           +YF +Q+PW L+K+  +    R  TVLY T EV+R  A+L+Q  +P+ A K+ D+L   +
Sbjct: 425 KYFSSQQPWILRKSESEADQARFRTVLYTTCEVVRIAALLVQPVMPESAGKMLDLLGQEE 484

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + R F ++  RL PG +L      +FPR+
Sbjct: 485 DQRAFTAVSVRLAPGTVLPPPTG-VFPRY 512


>gi|220913018|ref|YP_002488327.1| methionyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
 gi|219859896|gb|ACL40238.1| methionyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
          Length = 519

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 344/511 (67%), Gaps = 3/511 (0%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
            E+   YI+TAI YPN  PHIGHAYE I  D +ARF RLDG DV+F TGTDEHG KIA+ 
Sbjct: 4   SEKTPFYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVMFLTGTDEHGMKIAQT 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G+T K  VD+N+  ++   + L I+YD FIRTT++ H+   + +WKK+   GDIY 
Sbjct: 64  AEKEGITPKELVDRNAEIYKAAHEALGITYDRFIRTTDEDHYAASQAIWKKMEANGDIYL 123

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYY 180
             Y GWYS+RDEA+Y +DE     DG  Y+ + +  V W  EE YFFRLSAYQDKLL+ Y
Sbjct: 124 DKYEGWYSVRDEAFYGEDETVVKDDGVRYSKETDTEVTWTAEESYFFRLSAYQDKLLALY 183

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E+ PEF  P  R NEVISFVK GL+DLS+SR TFDWG+ +P +  ++MYVW+DALTNYLT
Sbjct: 184 EAQPEFGAPQSRFNEVISFVKRGLEDLSISRTTFDWGVPVPGNSNHVMYVWVDALTNYLT 243

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D       +FWPAD+HVIGKDI RFHAIYWPAFLLSA L LPK+V  HGF+ + G
Sbjct: 244 GVGYPDVDSEKFRRFWPADVHVIGKDISRFHAIYWPAFLLSAGLELPKRVMIHGFLHNNG 303

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKSLGNV+ P + +E+ G+D +R+F +RE+  G DG Y+ + +  R+N+DLAN  GN
Sbjct: 304 VKMSKSLGNVVAPADFVEQYGLDQVRFFFLREVPFGADGSYNHEAIVGRMNSDLANNFGN 363

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  RS+SM+ K+  G +PTPGAFT++D +IL     +L   R     Q   RAL  + ++
Sbjct: 364 LAQRSLSMVAKNCGGAVPTPGAFTDADTAILEQAGGLLDNARAAFDKQEFSRALEAIWAV 423

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           + + + YF  Q PW L+KT+ +R +TVLYVT+EV+R +AIL Q  +P    ++ D L   
Sbjct: 424 LGDTNAYFAEQAPWVLRKTDVERMNTVLYVTLEVLRIVAILAQPVMPGSTARLLDALGQP 483

Query: 481 D-ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + + R F ++  R+  G  L     P+FP++
Sbjct: 484 EGDARQFGAVATRIAAGTPLPAP-APVFPKY 513


>gi|15827034|ref|NP_301297.1| methionyl-tRNA synthetase [Mycobacterium leprae TN]
 gi|25009393|sp|Q9CD55|SYM_MYCLE RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|13092581|emb|CAC29746.1| putative methionyl-tRNA synthase [Mycobacterium leprae]
          Length = 537

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 249/509 (48%), Positives = 354/509 (69%), Gaps = 7/509 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+TAIAYPNA PHIGHAYE I  D +ARF RLDGLDV F TGTDEHG K+A+AA+ AGV
Sbjct: 5   YITTAIAYPNAAPHIGHAYEYIATDAIARFKRLDGLDVRFLTGTDEHGLKVAQAAEAAGV 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L IS+D FIRTT+  H+   + +W+++   GDIY G YSGW
Sbjct: 65  PTAQLARRNSGVFQRMQEALHISFDRFIRTTDADHYKAAKEIWRRMDAAGDIYLGTYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWME-EEGYFFRLSAYQDKLLSYYESHPE 185
           YS+RDE ++ D E     +G     +    V W E E+ YFFRLSAY DKLL++Y+++P+
Sbjct: 125 YSVRDERFFVDSETKLLDNGIRVAVETGTLVTWTEKEQTYFFRLSAYVDKLLAHYDANPD 184

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEVISFV  GL+D S+SR +FDWG+++P+ P ++MYVWIDALTNYLT  G+ 
Sbjct: 185 FIGPEVRRNEVISFVSGGLEDFSISRTSFDWGVQVPEHPDHVMYVWIDALTNYLTGAGFP 244

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D       ++WPA+LH+IGKDI+RFHA+YWPAFL+SA + LP+++F+HGF+ + GEK+SK
Sbjct: 245 DTDSELFGRYWPANLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNHGEKMSK 304

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GN++DP+ +++  GVD +RYFL+REI  G+DG Y ++ +  R+N DLAN  GNL  RS
Sbjct: 305 SVGNIVDPMALVQTFGVDQVRYFLLREIPFGQDGNYSEEAIITRMNTDLANEFGNLAQRS 364

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SM+ K+  G++P P  FT +D ++L+    +L+ +R N   Q ++ AL  +  ++ E +
Sbjct: 365 LSMVAKNLGGVVPEPSEFTSADTALLTTADGLLERVRGNFDGQAMNLALEAIWLMLGEAN 424

Query: 426 RYFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           +YF +Q+PW L+K+  +    R  TVLY T EV+R  A+L+Q  +P+ A K+ D+L   +
Sbjct: 425 KYFSSQQPWILRKSESEADQARFRTVLYTTCEVVRIAALLVQPVMPESAGKMLDLLGQEE 484

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + R F ++  RL PG +L      +FPR+
Sbjct: 485 DQRAFTAVSVRLAPGTVLPPPTG-VFPRY 512


>gi|326383789|ref|ZP_08205474.1| methionyl-tRNA synthetase [Gordonia neofelifaecis NRRL B-59395]
 gi|326197553|gb|EGD54742.1| methionyl-tRNA synthetase [Gordonia neofelifaecis NRRL B-59395]
          Length = 523

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/506 (50%), Positives = 348/506 (68%), Gaps = 5/506 (0%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+TAIAYPN  PHIGHAYE I ADVLARF  LDG DV F +GTDEHGQK+ + A+  G
Sbjct: 12  FYITTAIAYPNGAPHIGHAYEFISADVLARFKALDGFDVRFQSGTDEHGQKMQQTAEKEG 71

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           V+T      NS  F  +   L      FIRTT+  HH     +WK++   GDIY   Y+G
Sbjct: 72  VSTAELAKTNSDRFEALHMALGTDLSRFIRTTDTDHHRASEEIWKRMEAAGDIYLDSYAG 131

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPV-QWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WY +RDEA++ +DE    ADG+    ++  V  W EE+ YFFRLS YQD+LL+ Y+ HPE
Sbjct: 132 WYDVRDEAFFTEDETTVDADGRRVATENGHVLTWTEEQTYFFRLSNYQDRLLALYDEHPE 191

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEV SFV  GL DLS+SR TFDWG+K+P  P ++MYVW+DALTNYLT  G+ 
Sbjct: 192 FIGPDVRRNEVRSFVAGGLNDLSISRTTFDWGVKVPGAPDHVMYVWVDALTNYLTGVGFP 251

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D+ + + +++WPADLH+IGKDI+RFH +YWPAFL+SA L +P++VF+HGF+ ++GEK+SK
Sbjct: 252 DD-EQTLSRYWPADLHIIGKDIIRFHCVYWPAFLMSAGLEVPRRVFAHGFLFNRGEKMSK 310

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S+GNV+DP E++E+ G+DA+RYF +RE++ G+DG Y  D +  R NADLAN  GNL  R+
Sbjct: 311 SIGNVVDPHELVEQFGLDAVRYFFLREVSYGQDGSYSADAIVARNNADLANEYGNLAQRT 370

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +SMI K ++  +P PG FT++D ++L     +L ++RE    Q IH  L  V +++++ +
Sbjct: 371 LSMIGKYFESRVPQPGEFTDADRALLDAADALLPKVREQFDKQSIHLGLEAVWTVLADAN 430

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV--ADEN 483
           RY  AQ+PW+L KT+ DR  TVLYV  EV+R + +L+Q  +P+    + D+L V   DEN
Sbjct: 431 RYVSAQEPWKLAKTDLDRTGTVLYVCAEVVRIVTVLVQPVMPQSTATLLDLLAVPSGDEN 490

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPR 509
           R F ++  RL  G  L K   P+FPR
Sbjct: 491 RQFTAVVDRLAVGAELPKP-TPVFPR 515


>gi|296445799|ref|ZP_06887751.1| methionyl-tRNA synthetase [Methylosinus trichosporium OB3b]
 gi|296256627|gb|EFH03702.1| methionyl-tRNA synthetase [Methylosinus trichosporium OB3b]
          Length = 516

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 253/509 (49%), Positives = 350/509 (68%), Gaps = 9/509 (1%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           ISTAI Y N  PHIGHAYE I  D  ARF RLDG DVLF TG DEHGQK+ + A+  G+T
Sbjct: 2   ISTAIPYANGAPHIGHAYERIATDAFARFKRLDGYDVLFVTGMDEHGQKMQRTAEREGLT 61

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
            +   D+ +  F+ M + L+   DD +RTT+ RH  T   +W+++   GDIY   Y GWY
Sbjct: 62  PQQLADRTAAQFQTMGETLNALADDVVRTTQPRHAATVLEIWRRMEAAGDIYLAKYCGWY 121

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFIL 188
           S+RDEAYY++ E+ +  +G+       PV+W+EEE +FF+LSAY D+LL++YE+HP+FI 
Sbjct: 122 SVRDEAYYDESEISE-VEGKKLAPTGTPVEWVEEESWFFKLSAYADRLLAHYEAHPDFIT 180

Query: 189 PIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQ----YIMYVWIDALTNYLTTTGY 244
           P + +NE+++FVK GL DLS+SR TFDWGI +P+ P+    ++MYVW+DALTNY+T TG+
Sbjct: 181 PDKYKNEIVAFVKRGLSDLSISRTTFDWGIPVPEKPETNAKHVMYVWVDALTNYITATGF 240

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
           L   +G + +FWPA+ HVIGKDI RFHAIYWPAFL+SA  PLPK++  HGF+  +GEK+S
Sbjct: 241 LTG-EGDRTRFWPANAHVIGKDITRFHAIYWPAFLMSAGAPLPKQIVVHGFLFSRGEKMS 299

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGNV+DPI++    GVD LRYF +REI  G+DG Y  + +  R+NADLAN +GNL  R
Sbjct: 300 KSLGNVVDPIDLATRYGVDQLRYFFLREIPFGQDGNYSHEAIVNRINADLANDLGNLAQR 359

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S+SMI K+  G +P+PG  TE+D ++L+  +  L++ R  +     H ALA++  +V + 
Sbjct: 360 SLSMIAKNCGGKVPSPGELTEADRALLAEAAAALEKARAAIDAYAPHLALAEIFGVVGDA 419

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           +RYF  ++PW  KKT+P R  T+LYVT E +R+LAI LQ F+P  A  + ++L VA+  R
Sbjct: 420 NRYFAGEEPWTKKKTDPKRMETILYVTAEALRRLAIPLQPFIPSAAASLLNLLGVAESAR 479

Query: 485 CFQSLDQR--LKPGFMLHKTFDPIFPRFL 511
            F S  +   L  G  L     P+FPR++
Sbjct: 480 GFASAGETHALVSGAPLPAP-APVFPRYV 507


>gi|295396171|ref|ZP_06806353.1| methionine--tRNA ligase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970959|gb|EFG46852.1| methionine--tRNA ligase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 527

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/513 (49%), Positives = 349/513 (68%), Gaps = 12/513 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++TAIAYPN  PHIGHAYE I +D +ARF RL G DV   TGTDEHG K+ ++AQ AG
Sbjct: 3   FYMTTAIAYPNGAPHIGHAYEYIASDTIARFKRLTGEDVFMLTGTDEHGLKMQQSAQKAG 62

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T +   D+N+  FR + D L  SYD FIRTT+  H+   + LWKK+ + GDIY   Y+G
Sbjct: 63  ITPRELADKNAAGFRALHDALGSSYDRFIRTTDPDHYTASQDLWKKMDEAGDIYLDTYAG 122

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYN-AQHNPVQWMEEEGYFFRLSAYQDKLLSYYES--- 182
           WYS+RDEAYY  DE     DG+ Y  A   PV+W EEE YFF+LSAY+++LL + +S   
Sbjct: 123 WYSVRDEAYYAADETEVREDGERYAIATGTPVEWTEEESYFFKLSAYEERLLEWLDSVDD 182

Query: 183 ---HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
              HP  + P  RRNEV+SF+K GLKDLS+SR TFDWG+ +P + +++MYVW+DALTNYL
Sbjct: 183 TGRHP--VGPDVRRNEVVSFIKGGLKDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYL 240

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T  GY +       + WP +LHV+GKDILRFHA+YWPAFL+SA L LPK+V +HGF+ +K
Sbjct: 241 TGAGYPNVDSEEFQQRWPCELHVVGKDILRFHAVYWPAFLMSAGLELPKRVHAHGFLFNK 300

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           GEK+SKS+GNV+DP ++++  G+D LRYFL+REI+ G+DG Y    +  R NADLAN  G
Sbjct: 301 GEKMSKSVGNVVDPYDLVDAFGLDTLRYFLLREISYGQDGSYSAGAIIGRKNADLANEYG 360

Query: 360 NLVSRSVSMILKDYDGMIP--TPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           NLV RS SM+ K+  G++P  +    T+ D ++L     +L+ +   +  Q +HR +  +
Sbjct: 361 NLVQRSTSMVAKNLSGVVPEVSEADLTDDDRALLERTDGLLERVTAFVDVQELHRYVEAL 420

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
             ++ E +RYF AQ+PW+LKKT+PDR   VLYVT+EV+R+++IL Q  +P+   K+   L
Sbjct: 421 WRVLEETNRYFSAQEPWKLKKTDPDRMGVVLYVTLEVLRRVSILAQPVMPESTGKVLTQL 480

Query: 478 FVADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            VA++ R F    Q L  G  L     P+FPR+
Sbjct: 481 GVAEDARTFNDFGQWLPAGTELPAPA-PVFPRY 512


>gi|144899823|emb|CAM76687.1| Methionyl-tRNA synthetase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 518

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 251/510 (49%), Positives = 343/510 (67%), Gaps = 4/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  Y++T I Y N +PHIGHAY  +  DVLARF RLDG DV F TGTDEHGQK+ K+A+
Sbjct: 5   KKTFYVTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGYDVKFLTGTDEHGQKVEKSAE 64

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG++ +   D NS NFR++A  L+ S DDFIRTTE RH  + + LW K+   GDIY G 
Sbjct: 65  TAGISPQALADMNSANFRELAARLNCSNDDFIRTTEPRHVASVQALWNKLVQSGDIYLGH 124

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWYS+RDEA+Y +DE+  G +G        PV+W++E  YFFRLSA+QDKLL +YE +
Sbjct: 125 YEGWYSVRDEAFYGEDELVAGPNGGKLAPTGAPVEWVKEPSYFFRLSAWQDKLLQWYEDN 184

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+ + P  RRNEV+SFVK GL+DLS+SR +F WGI +P D  ++MYVW+DALTNY+T  G
Sbjct: 185 PDCVAPQSRRNEVMSFVKGGLQDLSVSRTSFKWGIPVPGDADHVMYVWLDALTNYITAVG 244

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y +  DG  A++WPADLH++GKDI+RFHA+YWPAFL++A +    +VF+HG+  ++G+KI
Sbjct: 245 YPEQ-DGDYARYWPADLHMVGKDIVRFHAVYWPAFLMAAGIKPATRVFAHGWWTNEGQKI 303

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP+ +IE+ G+D +RYFL+RE+  G DG Y    +  R+N++LAN  GNL  
Sbjct: 304 SKSVGNVIDPLGLIEKYGLDQVRYFLLREVPFGNDGDYSHRAMVMRMNSELANDYGNLAQ 363

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R +SM+ K+    +P  G F + D  +L     +L ++R+ M  QL H  L  +  ++  
Sbjct: 364 RVLSMVGKNCGNAVPVHGDFNDDDREMLDAAHGLLHKLRDAMDRQLFHEGLEALWVVIRA 423

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            + Y D Q PW LKKT+P R  TVL+V  E IR LA+L QAF+P  + K+ D L +A + 
Sbjct: 424 ANGYVDRQAPWALKKTDPARMGTVLWVLAETIRNLALLTQAFMPDSSAKLLDQLAIAADQ 483

Query: 484 RCFQSLDQR--LKPGFMLHKTFDPIFPRFL 511
           R          LKPG  L      +FPRF+
Sbjct: 484 RGLAQCGSHHALKPGTPL-PVPQGVFPRFV 512


>gi|119962681|ref|YP_948227.1| methionyl-tRNA synthetase [Arthrobacter aurescens TC1]
 gi|119949540|gb|ABM08451.1| methionyl-tRNA synthetase [Arthrobacter aurescens TC1]
          Length = 519

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/510 (49%), Positives = 344/510 (67%), Gaps = 3/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+   YI+TAI+YPN  PHIGHAYE+I  D +ARF RLDG +V F TGTDEHG K+ ++A
Sbjct: 5   EKSPFYITTAISYPNGVPHIGHAYEVIATDAMARFKRLDGHEVFFMTGTDEHGLKMQQSA 64

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  G+T K   D+NS  F+ M+  L IS+D FIRTT++ H+   + +WKK+   GDIY  
Sbjct: 65  EKEGLTAKQLADRNSAAFKQMSQDLGISHDRFIRTTDQDHYAASQAIWKKMEANGDIYLS 124

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYE 181
            Y GWYS+RDEAYY +D+     DG  Y+ + +  V W  EE YFFRLS YQDKLL+ YE
Sbjct: 125 KYEGWYSVRDEAYYVEDDTVVKDDGLRYSKETDTLVTWTAEESYFFRLSNYQDKLLALYE 184

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
             PEF  P  R NEVISFV+ GL+DLS+SR TFDWG+ +P D +++MYVW+DALTNYLT 
Sbjct: 185 EQPEFGAPQSRFNEVISFVRRGLEDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYLTG 244

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY D    S  KFWPAD+HVIGKDI RFHAIYWPAFL+SA L LPK+V  HGF+ + G 
Sbjct: 245 VGYPDIESESFKKFWPADVHVIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLTNNGV 304

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKSLGNV+ P + + + G+D  RYF +RE+  G DG Y+ + +  R+N+DLAN  GNL
Sbjct: 305 KMSKSLGNVVAPQDFVAQYGLDQCRYFFLREVPFGADGNYNHEAIVGRMNSDLANNFGNL 364

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS+SM+ K+ +G +P PG FT  D+++L+    +L   R     Q   RAL  + +++
Sbjct: 365 AQRSLSMVAKNCEGRVPEPGEFTAEDKALLAQAGELLDTARAAFDKQEFSRALEAIWTVL 424

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            + + YF  Q PW L+KT+ +R +TVLYVT+EV+R +AIL Q  +P  + K+ ++L   +
Sbjct: 425 GDTNAYFAEQAPWVLRKTDLERMNTVLYVTLEVVRIVAILAQPVMPSSSAKLLEVLGQPE 484

Query: 482 -ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            E+R F ++   +  G  L     P+FPR+
Sbjct: 485 GESRQFAAVATPIVAGTELPAP-APVFPRY 513


>gi|183984451|ref|YP_001852742.1| methionyl-tRNA synthetase MetS [Mycobacterium marinum M]
 gi|183177777|gb|ACC42887.1| methionyl-tRNA synthetase MetS [Mycobacterium marinum M]
          Length = 518

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 246/507 (48%), Positives = 347/507 (68%), Gaps = 5/507 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPNA PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+A+AA  A +
Sbjct: 5   YVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKVAQAAAAAEI 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L+IS+D FIRTT+  H++  + +W+++   GDIY   YSGW
Sbjct: 65  PTAQLARRNSDVFQRMQEALNISFDRFIRTTDADHYEASQEIWRRMDAAGDIYLDSYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+RDE ++ + E       +       PV W EE+ YFFRLSAY DKLL++YE++P+FI
Sbjct: 125 YSVRDERFFVESETQVVDGTRIATETGTPVTWTEEQTYFFRLSAYADKLLAHYEANPDFI 184

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  RRNEV+SFV  GLKDLS+SR +F+WG+ +P  P ++MYVW+DALTNYLT  GY D 
Sbjct: 185 APEVRRNEVVSFVSGGLKDLSVSRTSFNWGVPVPGHPDHVMYVWVDALTNYLTGAGYPDT 244

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  ++WPADLH+IGKDI+RFHA+YWPAFL+SA + LP++VF+HGF+ ++GEK+SKSL
Sbjct: 245 GSEAFLRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRVFAHGFLHNRGEKMSKSL 304

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDP+ +IE  GVD +RYFL+RE+  G+DG Y ++ +  R+N DLAN +GNL  RS+S
Sbjct: 305 GNTIDPMGLIETYGVDQVRYFLLREVPFGQDGSYSEEAIINRINTDLANELGNLAQRSLS 364

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRY 427
           MI K+  G +P PG F+ +D  +L++   +L+ +RE+  NQ +H AL  +  ++   ++Y
Sbjct: 365 MIAKNLGGAVPEPGEFSAADRELLAIADGLLERVREHFDNQSMHLALEAIWLMLGHANKY 424

Query: 428 FDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           F  Q+PW L+K+  +    R  T LY T E +R  A+L+   +P+ A K+ D+L    + 
Sbjct: 425 FSDQQPWVLRKSESEADQARFRTTLYTTCEAVRIAALLVAPVMPESAAKLLDLLGQGPDQ 484

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           R F ++  RL PG  +      +FPR+
Sbjct: 485 RSFNAIGARLVPGTAMPSPTG-VFPRY 510


>gi|163795498|ref|ZP_02189464.1| Methionyl-tRNA synthetase, class Ia [alpha proteobacterium BAL199]
 gi|159179097|gb|EDP63630.1| Methionyl-tRNA synthetase, class Ia [alpha proteobacterium BAL199]
          Length = 515

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 346/506 (68%), Gaps = 5/506 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I Y N +PHIGHAY  +  D LARF RLDG DV+F TGTDEHGQK+  AA  AGV
Sbjct: 6   YVTTPIYYVNDKPHIGHAYTTLACDALARFKRLDGYDVMFLTGTDEHGQKVEAAADAAGV 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F D+ S+NFRD+  V++ S DDFIRTTE RH    + LW+++ +KG IY G Y+GW
Sbjct: 66  DPQSFTDRVSQNFRDLIGVMNCSTDDFIRTTEPRHVTAVQALWRRLKEKGHIYLGSYAGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+RDEA+Y + E+    +G+       PV+W+EE  YFF LS +Q+ LL++YE++P+FI
Sbjct: 126 YSVRDEAFYVETEL-TTVNGEKRAPSGAPVEWVEEPSYFFDLSKWQEPLLAFYEANPDFI 184

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  RRNEV+SFV+ GL+DLS+SR +F WG+ +PDD  +IMYVW+DALTNY+T  GY D 
Sbjct: 185 APESRRNEVLSFVRGGLRDLSVSRTSFKWGVPVPDDDAHIMYVWLDALTNYITAAGYPDT 244

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
            DG  +K WPADLH++GKDILRFHA+YWPAFL+ A L +PK+VF+HG+   +G+K+SKSL
Sbjct: 245 -DGQYSKRWPADLHMVGKDILRFHAVYWPAFLMGAGLEVPKRVFAHGWWTVEGQKMSKSL 303

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDP  +++  G+D  RYF++RE+  G DG +    +  R+N++LAN +GNL  R +S
Sbjct: 304 GNAIDPAALVDTYGLDQFRYFMLRELPFGNDGDFSHRAMINRMNSELANDLGNLSQRVLS 363

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRY 427
           M+ K+  G +P PGAF  +DE++L     +L+  R     Q  H+AL  +  +V   +RY
Sbjct: 364 MVAKNCAGAVPQPGAFAAADEALLGAADALLESQRAAYDTQAFHKALDAIFDVVGRANRY 423

Query: 428 FDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQ 487
            D Q PW L+KT+P R +TVLY  VE IR +AILLQ  VP    ++ D L V  + R F 
Sbjct: 424 VDEQAPWTLRKTDPARMATVLYTLVETIRHVAILLQPIVPGSCERMLDQLAVPADARDFD 483

Query: 488 SL--DQRLKPGFMLHKTFDPIFPRFL 511
            L  D RL PG  L K  + +FPR++
Sbjct: 484 RLTPDYRLVPGTPLPKP-EGVFPRWV 508


>gi|118619731|ref|YP_908063.1| methionyl-tRNA synthetase [Mycobacterium ulcerans Agy99]
 gi|118571841|gb|ABL06592.1| methionyl-tRNA synthetase MetS [Mycobacterium ulcerans Agy99]
          Length = 518

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/507 (48%), Positives = 347/507 (68%), Gaps = 5/507 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPNA PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+A+AA  A +
Sbjct: 5   YVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKVAQAAAAADI 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L+IS+D FIRTT+  H++  + +W+++   GDIY   YSGW
Sbjct: 65  PTAQLARRNSDVFQRMQEALNISFDRFIRTTDSDHYEASQEIWRRMDAAGDIYLDSYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+RDE ++ + E       +      NPV W EE+ YFFRLSAY DKLL++YE++P+FI
Sbjct: 125 YSVRDERFFVESETQVVDGTRIATETGNPVTWTEEQTYFFRLSAYADKLLAHYEANPDFI 184

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  RRNEV+SFV  GLKDLS+SR +F+WG+ +P  P ++MYVW+DALTNYLT  GY D 
Sbjct: 185 APEVRRNEVVSFVSGGLKDLSVSRTSFNWGVPVPGHPDHVMYVWVDALTNYLTGAGYPDT 244

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  ++WPAD H+IGKDI+RFHA+YWPAFL+SA + LP++VF+HGF+ ++GEK+SKSL
Sbjct: 245 GSEAFLRYWPADQHMIGKDIIRFHAVYWPAFLMSAGIELPRRVFAHGFLHNRGEKMSKSL 304

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDP+ +IE  GVD +RYFL+RE+  G+DG Y ++ +  R+N DLAN +GNL  RS+S
Sbjct: 305 GNTIDPMGLIETYGVDQVRYFLLREVPFGQDGSYSEEAIINRINTDLANELGNLAQRSLS 364

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRY 427
           MI K+  G +P PG F+ +D  +L++   +L+ +RE+  NQ +H AL  +  ++   ++Y
Sbjct: 365 MIAKNLGGAVPEPGEFSAADRELLAIADGLLERVREHFDNQSMHLALEAIWLMLGHANKY 424

Query: 428 FDAQKPWELKK----TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           F  Q+PW L+K    T+  R  T LY T E +R  A+L+   +P+ A K+ D+L    + 
Sbjct: 425 FSDQQPWVLRKSESETDQARFRTTLYTTCEAVRIAALLVAPVMPESAAKLLDLLGQRPDQ 484

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           R F ++  RL PG  +      +FPR+
Sbjct: 485 RSFNAIGARLVPGTAMPSPTG-VFPRY 510


>gi|83593036|ref|YP_426788.1| methionyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|83575950|gb|ABC22501.1| methionyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
          Length = 519

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 252/508 (49%), Positives = 343/508 (67%), Gaps = 4/508 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I Y N +PHIGHAY  +  DVLARF RLDG DV F TGTDEHGQK+ K+A 
Sbjct: 5   KPPFYLTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVQKSAT 64

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG+  + F D+ S NFRD+A  ++ S D FIRTTE RH + C+ LW  + ++G+IY   
Sbjct: 65  AAGIDPQTFTDRVSANFRDLAAAMNFSNDAFIRTTEPRHKEACKALWTLLVERGEIYLDA 124

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY++RDEA+Y +DE+   ADG        PV+W+EE  YFFRLS +Q  LL  Y + 
Sbjct: 125 YRGWYAVRDEAFYGEDELTTAADGSRLAPTGAPVEWVEEPSYFFRLSKWQQPLLDLYAAR 184

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNEVISFVK GL DLS+SR TF WG+ +P D  ++MYVW+DALTNY+T  G
Sbjct: 185 PDFIAPDSRRNEVISFVKGGLTDLSISRTTFSWGVPVPGDEDHVMYVWLDALTNYITAVG 244

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           + D   G  A++WPA+LH++GKDILRFH +YWPAFL++A L +P +VF+HG+  ++G+KI
Sbjct: 245 FPDQ-TGDYARYWPANLHMVGKDILRFHTVYWPAFLMAAGLEVPGRVFAHGWWTNEGQKI 303

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVIDP  +IE  G+D +RYFL+RE+  G DG +    +  R+N +LAN +GNL  
Sbjct: 304 SKSVGNVIDPRALIETYGLDPVRYFLLREVPFGNDGDFSHRAMINRMNGELANDLGNLAQ 363

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R +SMI K+  G +P PG F+E D+++L+    +L ++R+ M  Q  H AL  +  ++  
Sbjct: 364 RVLSMIAKNCAGAVPEPGPFSEDDDALLAAAVALLDKVRQAMDRQAFHEALEAIWVVIRA 423

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            + Y D Q PW L+K +P R +TVLYV  EVIR++A+L+Q FVP  A ++ D L    E 
Sbjct: 424 ANGYVDRQAPWALRKNDPPRMATVLYVLAEVIRRVALLMQPFVPASAARMLDQLGQGPEA 483

Query: 484 RCFQSLDQR--LKPGFMLHKTFDPIFPR 509
           R   +L  R  L PG +L K  + IFPR
Sbjct: 484 RDTTALGDRPLLAPGTVLPKP-EGIFPR 510


>gi|229587041|ref|YP_002845542.1| methionyl-tRNA synthetase [Rickettsia africae ESF-5]
 gi|228022091|gb|ACP53799.1| Methionyl-tRNA synthetase [Rickettsia africae ESF-5]
          Length = 508

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 256/509 (50%), Positives = 352/509 (69%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T + Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPVYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+ +  DG        PV+W++E  YFF LS +QDKLL +YE+HP+FI
Sbjct: 126 YAVRDEAFFDESELTR--DGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEAHPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GYLD 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYNKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+ +++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKTDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|157826102|ref|YP_001493822.1| methionyl-tRNA synthetase [Rickettsia akari str. Hartford]
 gi|157800060|gb|ABV75314.1| methionyl-tRNA synthetase [Rickettsia akari str. Hartford]
          Length = 512

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/512 (49%), Positives = 354/512 (69%), Gaps = 19/512 (3%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL GLDV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRGLDVIFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +  V+ IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMAVMHISNDDFIRTTENRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+   +DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFFDESEL--TSDGLAPTGA--PVEWVKEPSYFFNLSQWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GY D 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYPDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              S  KFWPADLHV+GKDILRFH +YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSSYGKFWPADLHVVGKDILRFHTVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I E G+D +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ RS +
Sbjct: 301 GNTIDPIKLINEFGIDQIRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRSTA 360

Query: 368 MILKDYDGMIPTPGAFTES------DESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
            + K+ +G +P     T+S      +  IL   S+  ++    M    I++ L  +I+L 
Sbjct: 361 FVYKNNEGKVPL---LTQSVIDKIYELPILKTASKFAEQNILLMDKTEINKILDNIINLA 417

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            E + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+LQ F+P  ANK+ + L ++ 
Sbjct: 418 EEANIYIDSEAPWNLKKTDPDKMLEVLYTLLEVLRYIAIMLQPFIPSSANKMLNQLGISK 477

Query: 482 ENRCFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
           E R F+ L  D  L+ G  +L  T   IFPRF
Sbjct: 478 EERLFKHLIRDYALRAGSNILEPTI--IFPRF 507


>gi|67458627|ref|YP_246251.1| methionyl-tRNA synthetase [Rickettsia felis URRWXCal2]
 gi|75536907|sp|Q4UMX2|SYM_RICFE RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|67004160|gb|AAY61086.1| Methionyl-tRNA synthetase [Rickettsia felis URRWXCal2]
          Length = 512

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/514 (49%), Positives = 356/514 (69%), Gaps = 15/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA 
Sbjct: 2   KNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFIRLCGFDVMFLTGTDEHGQKVEKAAI 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           N  +  + F D  S +FR + +V++IS DDFIRTTE RH +   I W+K+ D G IY+G 
Sbjct: 62  NKNIDPQKFTDHTSESFRHLMNVMNISNDDFIRTTESRHKEAVAIFWQKLLDNGTIYEGF 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY++RDEA++++ E+   +DG        PV+W++E  YFF LS +QDKLL +YE++
Sbjct: 122 YEGWYAVRDEAFFDESEL--TSDGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEAN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL +Y++  G
Sbjct: 178 PDFIRPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALASYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D    +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KI
Sbjct: 238 YPDK-QSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKI 296

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ 
Sbjct: 297 SKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLVTRINSELSNKIGNLLQ 356

Query: 364 RSVSMILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           R+ + + K+ DG +P    G   +  E  IL   S+  ++    M+   I++ L  +I+L
Sbjct: 357 RTTAFVYKNNDGKVPLLMQGIIDKIYELPILKTASKFAEQNILLMEKTEINKVLENIINL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
             E + Y D++ PW LKKT+P++ S VLY  +EV+R +AI+LQ F+P  ANK+ D L V 
Sbjct: 417 SEEANIYIDSEAPWNLKKTDPEKMSEVLYTLLEVLRYIAIMLQPFIPSSANKMLDQLGVN 476

Query: 481 DENRCFQSL--DQRLKPGFMLHKTFDP--IFPRF 510
            E R F+ L  D  L+ G       +P  IFPRF
Sbjct: 477 KEERLFKHLIRDYALRAG---SSILEPAIIFPRF 507


>gi|238651000|ref|YP_002916856.1| methionyl-tRNA synthetase [Rickettsia peacockii str. Rustic]
 gi|238625098|gb|ACR47804.1| methionyl-tRNA synthetase [Rickettsia peacockii str. Rustic]
          Length = 508

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/509 (50%), Positives = 352/509 (69%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+ +  DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFFDESELTR--DGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GYLD 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+ +++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKTDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|325963761|ref|YP_004241667.1| methionyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323469848|gb|ADX73533.1| methionyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 520

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 254/510 (49%), Positives = 339/510 (66%), Gaps = 3/510 (0%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+   YI+TAI YPN  PHIGHAYE I  D +ARF RLDG DV+F TGTDEHG KIA+ A
Sbjct: 5   EKTPFYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVMFLTGTDEHGMKIAQTA 64

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  G+T K  VD+N+  ++     L I+YD FIRTT+  H+   + +WKK+   GDIY  
Sbjct: 65  EKEGITPKELVDRNAEVYKAAHAALGITYDRFIRTTDADHYAASQAIWKKMEANGDIYLS 124

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYE 181
            Y GWYS+RDEA+Y +D+     DG  Y+ + +  V W  EE YFFRLSAYQ+KLL+ YE
Sbjct: 125 KYEGWYSVRDEAFYGEDDTVVKDDGVRYSKETDTEVTWTAEESYFFRLSAYQEKLLALYE 184

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           + PEF  P  R NEVISFVK GL+DLS+SR TFDWG+ +P + +++MYVW+DALTNYLT 
Sbjct: 185 AQPEFGAPQYRFNEVISFVKRGLEDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTG 244

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY D       K+WPAD+H+IGKDI RFHAIYWPAFL+SA L LPK+V  HGF+ + G 
Sbjct: 245 VGYPDVDSEKFRKYWPADVHIIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLHNNGV 304

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKSLGNV+ P + + + G+D +RYF +RE+  G DG Y+ D +  R+NADLAN  GNL
Sbjct: 305 KMSKSLGNVVAPADFVAQYGLDQVRYFFLREVPFGADGSYNHDAIVGRMNADLANNFGNL 364

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
             RS+SM+ K+ +G +P PG FT +D +IL+  + +LQ +R     Q   RAL  V  ++
Sbjct: 365 AQRSLSMVAKNCEGRVPVPGEFTAADNAILAQANGLLQTVRAVFDKQEFSRALEAVWGVL 424

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            + + YF  Q PW L+KT+  R +TVLYVT+EV+R +AIL Q  +P     +   L   +
Sbjct: 425 GDTNAYFAEQAPWVLRKTDVGRMNTVLYVTLEVLRIVAILAQPVMPAATASLLAALGQPE 484

Query: 482 -ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            E R F ++   +  G  L     P+FP++
Sbjct: 485 GEARQFAAIATPIAAGTGLPAP-SPVFPKY 513


>gi|157828900|ref|YP_001495142.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933624|ref|YP_001650413.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
 gi|157801381|gb|ABV76634.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908711|gb|ABY73007.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
          Length = 508

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/509 (50%), Positives = 351/509 (68%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+ +  DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFFDESELTR--DGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GYLD 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  + G+KISKSL
Sbjct: 242 -QSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNDGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+ +++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKCVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKTDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|15840435|ref|NP_335472.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis CDC1551]
 gi|31792198|ref|NP_854691.1| methionyl-tRNA synthetase [Mycobacterium bovis AF2122/97]
 gi|121636936|ref|YP_977159.1| methionyl-tRNA synthetase [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148822217|ref|YP_001286971.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis F11]
 gi|215402823|ref|ZP_03415004.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis 02_1987]
 gi|215410610|ref|ZP_03419418.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis 94_M4241A]
 gi|215426286|ref|ZP_03424205.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T92]
 gi|215429868|ref|ZP_03427787.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis EAS054]
 gi|215445157|ref|ZP_03431909.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T85]
 gi|218752679|ref|ZP_03531475.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis GM 1503]
 gi|219556874|ref|ZP_03535950.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T17]
 gi|224989408|ref|YP_002644095.1| methionyl-tRNA synthetase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799963|ref|YP_003032964.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis KZN
           1435]
 gi|254231302|ref|ZP_04924629.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis C]
 gi|254363923|ref|ZP_04979969.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549993|ref|ZP_05140440.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185918|ref|ZP_05763392.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis CPHL_A]
 gi|260200036|ref|ZP_05767527.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T46]
 gi|260204225|ref|ZP_05771716.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis K85]
 gi|289442428|ref|ZP_06432172.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T46]
 gi|289446589|ref|ZP_06436333.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis CPHL_A]
 gi|289555210|ref|ZP_06444420.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis KZN 605]
 gi|289568984|ref|ZP_06449211.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T17]
 gi|289573647|ref|ZP_06453874.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis K85]
 gi|289744743|ref|ZP_06504121.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis 02_1987]
 gi|289749536|ref|ZP_06508914.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T92]
 gi|289753068|ref|ZP_06512446.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis EAS054]
 gi|289757090|ref|ZP_06516468.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T85]
 gi|289761143|ref|ZP_06520521.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis GM 1503]
 gi|294995197|ref|ZP_06800888.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis 210]
 gi|297633534|ref|ZP_06951314.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis KZN 4207]
 gi|297730519|ref|ZP_06959637.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis KZN R506]
 gi|298524503|ref|ZP_07011912.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis 94_M4241A]
 gi|306781942|ref|ZP_07420279.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu002]
 gi|306783703|ref|ZP_07422025.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu003]
 gi|306788058|ref|ZP_07426380.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu004]
 gi|306792391|ref|ZP_07430693.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu005]
 gi|306796794|ref|ZP_07435096.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu006]
 gi|306802680|ref|ZP_07439348.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu008]
 gi|306806859|ref|ZP_07443527.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu007]
 gi|306967060|ref|ZP_07479721.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu009]
 gi|313657848|ref|ZP_07814728.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis KZN V2475]
 gi|38258294|sp|P59952|SYM_MYCBO RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|13880605|gb|AAK45286.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis CDC1551]
 gi|31617786|emb|CAD93895.1| PROBABLE METHIONYL-TRNA SYNTHETASE METS (MetRS) (Methionine--tRNA
           ligase) [Mycobacterium bovis AF2122/97]
 gi|121492583|emb|CAL71051.1| Probable methionyl-trna synthetase metS [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600361|gb|EAY59371.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis C]
 gi|134149437|gb|EBA41482.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148720744|gb|ABR05369.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis F11]
 gi|224772521|dbj|BAH25327.1| methionyl-tRNA synthetase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253321466|gb|ACT26069.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis KZN
           1435]
 gi|289415347|gb|EFD12587.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis T46]
 gi|289419547|gb|EFD16748.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis CPHL_A]
 gi|289439842|gb|EFD22335.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis KZN 605]
 gi|289538078|gb|EFD42656.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis K85]
 gi|289542738|gb|EFD46386.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T17]
 gi|289685271|gb|EFD52759.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis 02_1987]
 gi|289690123|gb|EFD57552.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T92]
 gi|289693655|gb|EFD61084.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis EAS054]
 gi|289708649|gb|EFD72665.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis GM 1503]
 gi|289712654|gb|EFD76666.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis T85]
 gi|298494297|gb|EFI29591.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis 94_M4241A]
 gi|308325333|gb|EFP14184.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu002]
 gi|308331486|gb|EFP20337.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu003]
 gi|308335292|gb|EFP24143.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu004]
 gi|308339100|gb|EFP27951.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu005]
 gi|308342772|gb|EFP31623.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu006]
 gi|308346681|gb|EFP35532.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu007]
 gi|308350596|gb|EFP39447.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu008]
 gi|308355229|gb|EFP44080.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu009]
 gi|323720508|gb|EGB29590.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis
           CDC1551A]
 gi|326904766|gb|EGE51699.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis W-148]
 gi|328459706|gb|AEB05129.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis KZN
           4207]
          Length = 519

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/508 (49%), Positives = 354/508 (69%), Gaps = 7/508 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPNA PH+GHAYE I  D +ARF RLDG DV F TGTDEHG K+A+AA  AGV
Sbjct: 5   YVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVAQAAAAAGV 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L+IS+D FIRTT+  HH+  + LW+++S  GDIY   YSGW
Sbjct: 65  PTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDNYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+RDE ++ + E  +  DG     +   PV W EE+ YFFRLSAY DKLL++Y ++P+F
Sbjct: 125 YSVRDERFFVESET-QLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHANPDF 183

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEVISFV  GL DLS+SR +FDWG+++P+ P ++MYVW+DALTNYLT  G+ D
Sbjct: 184 IAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAGFPD 243

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                  ++WPADLH+IGKDI+RFHA+YWPAFL+SA + LP+++F+HGF+ ++GEK+SKS
Sbjct: 244 TDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKMSKS 303

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GN++DP+ + E +GVD +RYFL+RE+  G+DG Y  + +  R+N DLAN +GNL  RS+
Sbjct: 304 VGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQRSL 363

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+ DG +P PG F ++D ++L+    +L+ +R +   Q +H AL  +  ++ + ++
Sbjct: 364 SMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGDANK 423

Query: 427 YFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           YF  Q+PW L+K+  +    R  T LYVT EV+R  A+L+Q  +P+ A KI D+L  A  
Sbjct: 424 YFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQAPN 483

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F ++  RL PG  L      +FPR+
Sbjct: 484 QRSFAAVGVRLTPGTALPPPTG-VFPRY 510


>gi|108801230|ref|YP_641427.1| methionyl-tRNA synthetase [Mycobacterium sp. MCS]
 gi|119870381|ref|YP_940333.1| methionyl-tRNA synthetase [Mycobacterium sp. KMS]
 gi|126437210|ref|YP_001072901.1| methionyl-tRNA synthetase [Mycobacterium sp. JLS]
 gi|108771649|gb|ABG10371.1| methionyl-tRNA synthetase [Mycobacterium sp. MCS]
 gi|119696470|gb|ABL93543.1| methionyl-tRNA synthetase [Mycobacterium sp. KMS]
 gi|126237010|gb|ABO00411.1| methionyl-tRNA synthetase [Mycobacterium sp. JLS]
          Length = 515

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 343/511 (67%), Gaps = 6/511 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAIAYPN  PH+GHAYE I  D +ARF RLDG DV + TGTD HGQK+A+ A  
Sbjct: 3   QPFYITTAIAYPNGDPHVGHAYEYIATDAIARFKRLDGYDVRYLTGTDVHGQKMAETATA 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            GV       +NS  F+ + + L+IS+D FIRT++  H+     +W++++  GDIY   Y
Sbjct: 63  LGVPVADLARRNSDVFQRLQEKLNISFDRFIRTSDTDHYRASEDIWQRMNAAGDIYLDAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           SGWYS+RDE ++ + E     DG     +   P+ W EE+ YFF+LSAY D+LL++YE+H
Sbjct: 123 SGWYSVRDERFFTEGETTLREDGVRIATETGAPLTWTEEQTYFFKLSAYTDRLLAHYEAH 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNE++SFV  GL+DLS+SR TFDWG+ +PD P ++MYVW+DALTNYLT  G
Sbjct: 183 PEFIQPDARRNEIVSFVSGGLRDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D       ++WPADLH+IGKDI+RFH +YWPAFL+SA L LP+KVF+HG++L++GEK+
Sbjct: 243 YPDTSSEEFQRYWPADLHMIGKDIIRFHTVYWPAFLMSAGLELPRKVFAHGWLLNRGEKM 302

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNV+DP+ +++  G+D +RYF +RE+  G+DG Y +D +  R+NADLAN +GNL  
Sbjct: 303 SKSIGNVVDPVNLVDTFGLDQVRYFFLREVPFGQDGSYSEDAIIGRINADLANELGNLAQ 362

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS+SM+ K+    +P PG FT  D ++L     ++  +R +   Q +H AL  + S++  
Sbjct: 363 RSLSMVAKNLGSAVPEPGEFTAEDLALLDAADALMDRVRRHFDEQAMHLALEAIWSVLGA 422

Query: 424 VDRYFDAQKPWELKKT----NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
            +RYF AQ+PW L+K+    +  R  TVLY T+E +R  A+L Q  +P     + D++  
Sbjct: 423 ANRYFSAQEPWVLRKSEAVHDQVRFRTVLYTTLETVRIAALLSQPVMPDSTATLLDLVGQ 482

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             + R F ++  RL PG  L K    +FPR+
Sbjct: 483 PADQRTFAAVSTRLTPGTALPKPVG-VFPRY 512


>gi|15892969|ref|NP_360683.1| methionyl-tRNA synthetase [Rickettsia conorii str. Malish 7]
 gi|25009381|sp|Q92GS6|SYM_RICCN RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|15620165|gb|AAL03584.1| methionyl-tRNA synthetase [Rickettsia conorii str. Malish 7]
          Length = 508

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/509 (50%), Positives = 351/509 (68%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH     + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKKAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+ +  DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFFDESELTR--DGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GYLD 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYNKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+ +++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKTDPDKMLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|34581336|ref|ZP_00142816.1| methionyl-tRNA synthetase [Rickettsia sibirica 246]
 gi|28262721|gb|EAA26225.1| methionyl-tRNA synthetase [Rickettsia sibirica 246]
          Length = 508

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 352/509 (69%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y+++DEA++++ E+ +  DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVQDEAFFDESELTR--DGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GYLD 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYNKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+V+++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKVVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKK +PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKIDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|332185017|ref|ZP_08386766.1| methionyl-tRNA synthetase [Sphingomonas sp. S17]
 gi|332014741|gb|EGI56797.1| methionyl-tRNA synthetase [Sphingomonas sp. S17]
          Length = 518

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 335/512 (65%), Gaps = 10/512 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+TAI YPN +PHIGHAYEM+ ADV+ARF R  G DVLF TGTDEHG K+A+AA+ 
Sbjct: 3   DPFYITTAIHYPNGRPHIGHAYEMVAADVIARFQRQAGRDVLFQTGTDEHGLKMAQAARA 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G++T+ F D+ S  F  MAD LDISYD FIRT +  H+   + +WK +  KGD+Y   Y
Sbjct: 63  RGISTREFADEMSSYFHVMADRLDISYDRFIRTVDADHYAASQAIWKAMQAKGDLYLDRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y++ E+  G DG   + Q  PV+W  EE +FFRLS YQ  LL  Y  +P
Sbjct: 123 EGWYSVRDEAFYDEAELTLGEDGTKLSPQGTPVEWTAEETWFFRLSKYQQPLLDLYRDNP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEV+ FV+ GL DLS+SR +FDWG+ +PD P ++MYVW+DALTNYLT TGY
Sbjct: 183 DFIRPESRRNEVMRFVEGGLSDLSVSRTSFDWGVPVPDSPGHVMYVWVDALTNYLTGTGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
             N D   A+FWPA+LH+IGKDI+RFH +YWPAFL+SA+LPLP+ VF HGF+LH+GEK+S
Sbjct: 243 -PNKDSELARFWPANLHLIGKDIVRFHTVYWPAFLMSADLPLPQSVFGHGFLLHRGEKMS 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP+ + +  GVDALRYF +RE++ G+DG Y  + +  RVNA+LAN  GNL  R
Sbjct: 302 KSVGNVVDPMGLADAFGVDALRYFFLREVSFGQDGSYSAEAIVTRVNAELANSFGNLAQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++S I K+  G +P  G    +D  ++         ++    + ++ + +   +  V   
Sbjct: 362 TLSFIAKNLGGALPEAGRSDPTDAMLIEEVVVACAGLKTAFDDLMLSQGIEAWMRGVYAC 421

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           ++Y D Q PW L+KT+P+R   VL   V  IR LAI +    P+ A ++ D L    E R
Sbjct: 422 NQYIDVQAPWSLRKTDPERMHAVLGTLVRAIRMLAIAILPVTPRGAGQVLDTL--GAEER 479

Query: 485 CFQSLD------QRLKPGFMLHKTFDPIFPRF 510
              ++D      +R   G  L     P FPR 
Sbjct: 480 DHAAIDDDGWYARRAATGVPLSPP-TPAFPRL 510


>gi|163839798|ref|YP_001624203.1| methionyl-tRNA synthetase [Renibacterium salmoninarum ATCC 33209]
 gi|162953274|gb|ABY22789.1| methionyl-tRNA synthetase [Renibacterium salmoninarum ATCC 33209]
          Length = 529

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 355/510 (69%), Gaps = 5/510 (0%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++TAI YPN  PHIGHAYE + AD LARF RLDG DV + +GTDEHG K+ +AA+
Sbjct: 7   KRPYYLTTAITYPNGVPHIGHAYEYVSADALARFKRLDGFDVFYMSGTDEHGIKVQQAAE 66

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT    VD+NS   R + D+++ SYD FIRTTE  H+   + LW+++   GDIY   
Sbjct: 67  KEGVTPLELVDRNSAAIRAVHDLVESSYDRFIRTTEPEHYLASQELWRRMEANGDIYLDK 126

Query: 124 YSGWYSLRDEAYYNDDEVYKGADG-QYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y+GWYS+RDEAYY D++    ADG +Y       V W EEE YFFRLS YQ+KLL+ YE+
Sbjct: 127 YTGWYSVRDEAYYTDEQTELRADGIRYAIETETEVTWTEEESYFFRLSNYQEKLLALYEA 186

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
            PEF  P  R NEVISFVKSGL+DLS+SR +F+WG+ +P + +++MYVW+DALTNYLT  
Sbjct: 187 QPEFAAPQYRFNEVISFVKSGLQDLSISRTSFNWGVPVPGNDKHVMYVWVDALTNYLTGA 246

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+ D    S+ K+WPAD+H+IGKDI RFHAI+WP FL+SA LPLPK+V  HGF+ + G K
Sbjct: 247 GFPDE-SSSQWKYWPADVHIIGKDISRFHAIFWPGFLMSAGLPLPKRVMIHGFLFNNGVK 305

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+ P + +   GVDA+R+F +RE++ G+DG Y  + +  R N+DLAN +GNL 
Sbjct: 306 MSKSFGNVVAPADWVAAYGVDAVRFFFLREVSYGQDGNYSHEAIISRKNSDLANNLGNLA 365

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            RS+SM+ K+ DG++PTPG F+ +D++IL+    +L   R + + Q  HRAL  + +++ 
Sbjct: 366 QRSLSMVAKNCDGVVPTPGEFSSADQAILAKAQALLAANRASYEVQEFHRALEAIWAVLG 425

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV--A 480
           + + YF  Q PW L+KT+P+R +TVLYVT+EV+R +A+L+Q  +P  A K+ D+L V  A
Sbjct: 426 DTNAYFADQAPWVLRKTDPERMATVLYVTLEVLRIVALLIQPVMPGSAAKLLDVLGVSAA 485

Query: 481 DENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           +  R F +++  L  G  L     PIFPR+
Sbjct: 486 EGARDFTAVETPLVAGTALPAP-SPIFPRY 514


>gi|15608147|ref|NP_215523.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis H37Rv]
 gi|148660789|ref|YP_001282312.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis H37Ra]
 gi|167968135|ref|ZP_02550412.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis H37Ra]
 gi|306775143|ref|ZP_07413480.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu001]
 gi|306971250|ref|ZP_07483911.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu010]
 gi|307078978|ref|ZP_07488148.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu011]
 gi|307083539|ref|ZP_07492652.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu012]
 gi|3122902|sp|O05593|SYM_MYCTU RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|2052144|emb|CAB08142.1| PROBABLE METHIONYL-TRNA SYNTHETASE METS (MetRS) (Methionine--tRNA
           ligase) [Mycobacterium tuberculosis H37Rv]
 gi|148504941|gb|ABQ72750.1| methionyl-tRNA synthetase [Mycobacterium tuberculosis H37Ra]
 gi|308216293|gb|EFO75692.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu001]
 gi|308359184|gb|EFP48035.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu010]
 gi|308363118|gb|EFP51969.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu011]
 gi|308366750|gb|EFP55601.1| methionyl-tRNA synthetase metS [Mycobacterium tuberculosis SUMu012]
          Length = 519

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/508 (49%), Positives = 353/508 (69%), Gaps = 7/508 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++TAIAYPNA PH+GHAYE I  D +ARF RLD  DV F TGTDEHG K+A+AA  AGV
Sbjct: 5   YVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDRYDVRFLTGTDEHGLKVAQAAAAAGV 64

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
            T     +NS  F+ M + L+IS+D FIRTT+  HH+  + LW+++S  GDIY   YSGW
Sbjct: 65  PTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDNYSGW 124

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           YS+RDE ++ + E  +  DG     +   PV W EE+ YFFRLSAY DKLL++Y ++P+F
Sbjct: 125 YSVRDERFFVESET-QLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHANPDF 183

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNEVISFV  GL DLS+SR +FDWG+++P+ P ++MYVW+DALTNYLT  G+ D
Sbjct: 184 IAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAGFPD 243

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                  ++WPADLH+IGKDI+RFHA+YWPAFL+SA + LP+++F+HGF+ ++GEK+SKS
Sbjct: 244 TDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKMSKS 303

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GN++DP+ + E +GVD +RYFL+RE+  G+DG Y  + +  R+N DLAN +GNL  RS+
Sbjct: 304 VGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQRSL 363

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           SM+ K+ DG +P PG F ++D ++L+    +L+ +R +   Q +H AL  +  ++ + ++
Sbjct: 364 SMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGDANK 423

Query: 427 YFDAQKPWELKKTNPD----RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           YF  Q+PW L+K+  +    R  T LYVT EV+R  A+L+Q  +P+ A KI D+L  A  
Sbjct: 424 YFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQAPN 483

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            R F ++  RL PG  L      +FPR+
Sbjct: 484 QRSFAAVGVRLTPGTALPPPTG-VFPRY 510


>gi|157964833|ref|YP_001499657.1| methionyl-tRNA synthetase [Rickettsia massiliae MTU5]
 gi|157844609|gb|ABV85110.1| Methionyl-tRNA synthetase [Rickettsia massiliae MTU5]
          Length = 508

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/509 (49%), Positives = 348/509 (68%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S  FR +   + IS DDFIRTTE RH +   + W+K+ + G IY+G Y GW
Sbjct: 66  DPQQFTDQTSEIFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLENGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA++++ E+   +DG        PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFFDESEL--TSDGLAPTGA--PVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+ ++ ++++YVW+DAL NY++  GY D 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVSNNEKHVIYVWLDALANYISALGYPDK 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPADLHV+GKDILRFHA+YWPAFL++A +PLPK +  HG+  ++G+KISKSL
Sbjct: 242 -QSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMVHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ D  +P  T G   +  E  IL   S+ +++    M    I++ L  +I+L  E 
Sbjct: 361 FVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKKT+PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKTDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLIRDYTLTAGSNILEPTI--IFPKF 507


>gi|329113410|ref|ZP_08242191.1| Methionyl-tRNA synthetase [Acetobacter pomorum DM001]
 gi|326697235|gb|EGE48895.1| Methionyl-tRNA synthetase [Acetobacter pomorum DM001]
          Length = 512

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 238/506 (47%), Positives = 340/506 (67%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T I Y N  PHIGHAY  I ADV+ARFHRL G +V F TGTDEHGQK+ +AAQ  
Sbjct: 4   RFYVTTPIYYVNGAPHIGHAYTSIAADVMARFHRLAGDEVFFLTGTDEHGQKVEQAAQAN 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+  K F D+ S +FR+MAD ++ISYDDFIRTTE RH  + + LWKK++D G IY G Y 
Sbjct: 64  GIDAKSFADKVSADFRNMADAMNISYDDFIRTTEPRHITSTQALWKKVADNGAIYLGAYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY+LRDE +Y +DE+  G DG+       PV+W++E  YFF+LS YQD+LL  YE++P+
Sbjct: 124 GWYALRDECFYGEDELVPGPDGKKVAPTGAPVEWVKEPSYFFKLSEYQDRLLELYENNPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P   RNE++SFVK GL+DLS+SR +F WGI +P D +++MYVW DAL NYL+  GY 
Sbjct: 184 FLGPHGARNEIVSFVKQGLRDLSISRTSFKWGIPVPGDDKHVMYVWFDALANYLSALGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D     +  FWPA+LH++GKDI RFHA+YWPAFL++A + LP+KVF++G+   +G+K+SK
Sbjct: 244 DT-SAPRMAFWPANLHLVGKDIARFHAVYWPAFLMAAGIELPRKVFANGWWTIEGQKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV+DP ++++E G+DA+R+FL+RE+  G D    +  L  R N +LAN +GNL  R+
Sbjct: 303 SLGNVVDPRDLVKEFGLDAVRFFLLREVPFGGDSDLSRKALIMRNNVELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S++ ++  G++P     TE D  +L     +   ++  ++   +  AL  V  ++   +
Sbjct: 363 LSLVARNCGGVLPERRTLTEEDTHLLGQVMVLPDLLKSQIERCALTDALEDVWKVIRACN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW L+KT+P+R   VL V V+ +R +A +LQ F+P+   ++ D L V  E R 
Sbjct: 423 AYIDHQAPWALRKTDPERMKDVLRVLVDALRGIATMLQPFMPQSMERMLDQLSVTAEERS 482

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F +L+  L  G  L      IFPR++
Sbjct: 483 FAALETPLPGGRQLPAP-QGIFPRYV 507


>gi|296284128|ref|ZP_06862126.1| methionyl-tRNA synthetase [Citromicrobium bathyomarinum JL354]
          Length = 520

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/517 (48%), Positives = 345/517 (66%), Gaps = 19/517 (3%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAI YPN +PHIGHAYE + ADV+ARF RL G DV F TGTDEHG K+A+ A+ 
Sbjct: 3   EPYYITTAIHYPNGKPHIGHAYETVAADVIARFQRLKGRDVRFQTGTDEHGLKMARKAEE 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G T +   D+ S  FRD+ D L+ISYD FIRTTE  HH   + LW+++   GD+Y   Y
Sbjct: 63  QGKTPRELADEMSGYFRDLFDRLNISYDRFIRTTEAGHHTASQALWRRMEANGDLYLDRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y++ E+ +G  G+  + Q  PV+W  EE +FFRLS YQDKLL  Y S P
Sbjct: 123 EGWYSVRDEAFYDEKELVEGEGGEKLSPQGTPVEWTVEESWFFRLSKYQDKLLDLYASQP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEV+ FV+ GL+DLS+SR +FDWG+++P    ++MYVW+DALTNY++  GY
Sbjct: 183 DFIQPDSRRNEVMRFVEGGLRDLSISRTSFDWGVQVPGAEDHVMYVWVDALTNYISGLGY 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            +  +G+  K+WPADLH+IGKDI+RFH +YWPAFL+SA + LP++V+ HGF+L++G+K S
Sbjct: 243 PE--EGADWKYWPADLHLIGKDIIRFHTVYWPAFLMSAGVDLPRQVYGHGFLLNRGQKES 300

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGNV DP  + E+ GVDALRYFL+REIA G+DG Y  + +  R NA+LAN  GNL  R
Sbjct: 301 KSLGNVTDPNVLAEQFGVDALRYFLMREIAFGQDGSYSPEAIVTRANAELANSFGNLAQR 360

Query: 365 SVSMILKDYDGMIPTPGAFTES--DESILSVCSRVLQEIRENMQNQLIHRALAQVIS--- 419
           ++SMI K+ DG +   GA++ +  D+++L+    V    RE +  Q    A +  I    
Sbjct: 361 TLSMIAKNLDGEL---GAYSPAGDDKALLTT---VQDACREGLPKQFEKLAFSTGIEAWM 414

Query: 420 -LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
             V   ++Y D Q PW LKKT+P+R  TVL      +R LAI +Q  +P+ A+ +  +L 
Sbjct: 415 KAVYACNQYVDEQAPWALKKTDPERMRTVLQTLFIALRDLAIAIQPVIPEKADHLLTMLG 474

Query: 479 VADENRCFQSLDQRLKPGFMLHKTF-----DPIFPRF 510
           +A++ R F+ L      G ++   +      P+FPR 
Sbjct: 475 IAEDARTFEDLADEGWYGALVRTGYRVAPPSPLFPRL 511


>gi|258542241|ref|YP_003187674.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633319|dbj|BAH99294.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636378|dbj|BAI02347.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639431|dbj|BAI05393.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642487|dbj|BAI08442.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645542|dbj|BAI11490.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648595|dbj|BAI14536.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651648|dbj|BAI17582.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654639|dbj|BAI20566.1| methionyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-12]
          Length = 512

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 238/506 (47%), Positives = 340/506 (67%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T I Y N  PHIGHAY  I ADV+ARFHRL G +V F TGTDEHGQK+ +AAQ  
Sbjct: 4   RFYVTTPIYYVNGAPHIGHAYTSIAADVMARFHRLAGDEVFFLTGTDEHGQKVEQAAQAN 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   K F D+ S +FR+MAD ++ISYDDFIRTTE RH  + + LWKK++D G IY G Y 
Sbjct: 64  GTDAKSFADKVSADFRNMADAMNISYDDFIRTTEPRHITSTQALWKKVADNGAIYLGAYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY+LRDE +Y +DE+  G DG+       PV+W++E  YFF+LS YQD+LL  YE++P+
Sbjct: 124 GWYALRDECFYGEDELVPGPDGKKVAPTGAPVEWVKEPSYFFKLSEYQDRLLELYENNPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P   RNE++SFVK GL+DLS+SR +F WGI +P D +++MYVW DAL NYL+  GY 
Sbjct: 184 FLGPHGARNEIVSFVKQGLRDLSISRTSFKWGIPVPGDDKHVMYVWFDALANYLSALGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  +  +  FWPA+LH++GKDI RFHA+YWPAFL++A + LP+KVF++G+   +G+K+SK
Sbjct: 244 DT-NAPRMAFWPANLHLVGKDIARFHAVYWPAFLMAAGIELPRKVFANGWWTIEGQKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV+DP ++++E G+DA+R+FL+RE+  G D    +  L  R N +LAN +GNL  R+
Sbjct: 303 SLGNVVDPRDLVKEFGLDAVRFFLLREVPFGGDSDLSRKALIMRNNVELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S++ ++  G++P     TE D  +L     +   ++  ++   +  AL  V  ++   +
Sbjct: 363 LSLVARNCGGILPERRELTEEDTHLLGQVMVLPDLLKSQIERCALTDALEDVWKVIRACN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW L+KT+P+R   VL V V+ +R +A +LQ F+P+   ++ D L V  E R 
Sbjct: 423 AYIDHQAPWALRKTDPERMKDVLRVLVDALRGIATMLQPFMPQSMERMLDQLAVTAEERS 482

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F +L+  L  G  L      IFPR++
Sbjct: 483 FAALEMPLPGGRQLPAP-QGIFPRYV 507


>gi|157827625|ref|YP_001496689.1| methionyl-tRNA synthetase [Rickettsia bellii OSU 85-389]
 gi|157802929|gb|ABV79652.1| methionyl-tRNA synthetase [Rickettsia bellii OSU 85-389]
          Length = 509

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/513 (48%), Positives = 347/513 (67%), Gaps = 21/513 (4%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G +V+F TGTDEHGQK+ KAA +  +
Sbjct: 6   YITTPIYYVNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAAIDKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S++FR +   + IS DDFIRTTE+RH     I W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSQSFRHLMTAMHISNDDFIRTTEERHKKAVAIFWQKLLDNGSIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA+Y++ E+          A    V+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFYDESELTADKLAPTGAA----VEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P+D ++++YVW+DAL NY++  GY D 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNDNKHVIYVWLDALANYISALGYPDQ 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
            + +  KFWPA+L V+GKDILRFHAIYWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -NSNYGKFWPANLQVVGKDILRFHAIYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++IEE GVD +RYFL+REI  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIEEFGVDQVRYFLMREITFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDESILSVCSRVLQEIREN---MQNQLIHRALAQVISLVS 422
            + K+ DG +P  T  A  +  E  L +    +   ++N   M+   I++ L  +I+L  
Sbjct: 361 FVYKNNDGKVPAITQDAINKIYE--LPLLKTAINSAKQNILLMEKTEINKILDNIINLAE 418

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E + Y D++ PW LKKT+P++   VLY  +E +R +A++LQAF+P  A K+ D L V  E
Sbjct: 419 EANIYIDSEAPWNLKKTDPEKMLEVLYALLETLRYIAVMLQAFMPSSAGKMLDQLGVNTE 478

Query: 483 NRCFQSLDQRLKPGFMLHKTFD-----PIFPRF 510
            R F+ L       F L    D      +FPRF
Sbjct: 479 ERLFKHLSLE----FALTSASDILEPVIVFPRF 507


>gi|91205053|ref|YP_537408.1| methionyl-tRNA synthetase [Rickettsia bellii RML369-C]
 gi|123388147|sp|Q1RJZ5|SYM_RICBR RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|91068597|gb|ABE04319.1| Methionyl-tRNA synthetase [Rickettsia bellii RML369-C]
          Length = 509

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/513 (48%), Positives = 347/513 (67%), Gaps = 21/513 (4%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL G +V+F TGTDEHGQK+ KAA +  +
Sbjct: 6   YITTPIYYVNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAAIDKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S++FR +   + IS DDFIRTTE+RH     I W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSQSFRHLMTAMHISNDDFIRTTEERHKKAVAIFWQKLLDNGSIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA+Y++ E+          A    V+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFYDESELTADKLAPTGAA----VEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P+D ++++YVW+DAL NY++  GY D 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNDNKHVIYVWLDALANYISALGYPDQ 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
            + +  KFWPA+L V+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -NSNYGKFWPANLQVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++IEE GVD +RYFL+REI  G DG + +  L  R+N++L+N IGNL+ R+ S
Sbjct: 301 GNTIDPIKLIEEFGVDQVRYFLMREITFGADGNFARSNLITRINSELSNKIGNLLQRTTS 360

Query: 368 MILKDYDGMIP--TPGAFTESDESILSVCSRVLQEIREN---MQNQLIHRALAQVISLVS 422
            + K+ DG +P  T  A  +  E  L +    +   ++N   M+   I++ L  +I+L  
Sbjct: 361 FVYKNNDGKVPAITQDAINKIYE--LPLLKTAINSAKQNILLMEKTEINKILDNIINLAE 418

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           E + Y D++ PW LKKT+P++   VLY  +E +R +A++LQAF+P  A K+ D L V  E
Sbjct: 419 EANIYIDSEAPWNLKKTDPEKMLEVLYALLETLRYIAVMLQAFMPSSAGKMLDQLGVNTE 478

Query: 483 NRCFQSLDQRLKPGFMLHKTFD-----PIFPRF 510
            R F+ L       F L    D      +FPRF
Sbjct: 479 ERLFKHLSLE----FALTSASDILEPVIVFPRF 507


>gi|239948424|ref|ZP_04700177.1| methionyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|241563440|ref|XP_002401705.1| methionyl-tRNA synthetase, putative [Ixodes scapularis]
 gi|215501897|gb|EEC11391.1| methionyl-tRNA synthetase, putative [Ixodes scapularis]
 gi|239922700|gb|EER22724.1| methionyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 508

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/509 (49%), Positives = 347/509 (68%), Gaps = 13/509 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  + +DV+ARF RL   DV+F TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRSFDVMFLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S +FR +   + IS DDFIRTTE RH +   + W+K+ D G IY+G Y GW
Sbjct: 66  DPQKFTDQTSESFRHLMTAMHISNDDFIRTTENRHKEAVAVFWQKLLDNGTIYEGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA+Y++ E+ +G           PV+W++E  YFF LS +QDKLL +YE++P+FI
Sbjct: 126 YAVRDEAFYDESELTEGKLA----PMGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++   Y D 
Sbjct: 182 RPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISVLDYPDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPA+LHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYGKFWPANLHVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ +
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTA 360

Query: 368 MILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
            + K+ DG +P  T     +  E  IL   S+  ++    M    I++ L ++I+L  E 
Sbjct: 361 FVYKNNDGKVPLLTQDVIDKIYELPILKNASKFAEQNILLMDKTEINKILEKIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D++ PW LKK +PD+   VLY  +EV+R +AI+L  F+P  ANK+ D L V  E R
Sbjct: 421 NIYIDSEAPWNLKKIDPDKMLEVLYTLLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER 480

Query: 485 CFQSL--DQRLKPGF-MLHKTFDPIFPRF 510
            F+ L  D  L  G  +L  T   IFP+F
Sbjct: 481 LFKHLVRDYALTAGSNILEPTI--IFPKF 507


>gi|330994631|ref|ZP_08318554.1| Methionyl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
 gi|329758272|gb|EGG74793.1| Methionyl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
          Length = 512

 Score =  508 bits (1308), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/508 (48%), Positives = 335/508 (65%), Gaps = 6/508 (1%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T I Y N  PHIGHAY  + ADV+ARF RL G DV F TGTDEHGQK+ +AAQ A
Sbjct: 4   RYYVTTPIYYVNGAPHIGHAYTSVAADVIARFKRLAGFDVFFLTGTDEHGQKVEQAAQAA 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+T   F D+ + +FRDM D + ISYDDFIRTTE RH    + LWKK+ + G IY   Y 
Sbjct: 64  GMTPIAFADRVAADFRDMYDTMAISYDDFIRTTEPRHVQGAQALWKKLEENGHIYLDAYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY+ RDE +Y ++E+  G DG+        V+W++E  YFF LS + D+LL  YE+ P 
Sbjct: 124 GWYATRDECFYGEEELIDGPDGKKVAPTGAAVEWVKEPSYFFDLSRFGDRLLELYETRPG 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEVISFVK GL++LS+SR +F WGI +P DP+++MYVW+DAL NYL+  GY 
Sbjct: 184 FIEPASRRNEVISFVKQGLRNLSVSRTSFSWGIPVPGDPKHVMYVWVDALANYLSAVGY- 242

Query: 246 DNPDGSKAK--FWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
             PD   A+  FWPA+LH++GKDILRFHAIYWPA L++A LPLP +VFSHG+   +G+K+
Sbjct: 243 --PDAGAARWGFWPANLHLVGKDILRFHAIYWPALLMAAGLPLPDRVFSHGWWTIEGQKM 300

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNV+DP +++ E G+D +R+FL+RE+  G D    +  +  R+N +LAN +GNL  
Sbjct: 301 SKSLGNVVDPRDLVTEFGLDPIRFFLMREMPFGGDSDLSRRAIISRMNVELANDLGNLAQ 360

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R++S I ++ DG +P  G  T  D  +L+  S ++Q + E +  Q +  AL +V  L+  
Sbjct: 361 RTLSQIARNCDGKLPPQGTHTPEDTKLLAPASLLVQIMHEQIDRQALTDALEEVWKLIRA 420

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            + Y D Q PW+LKKT+  R   VL V  + +R +A +LQ ++P   +++   L VA+  
Sbjct: 421 CNAYIDHQAPWKLKKTDAARMGDVLRVLADALRIIATVLQPYMPGSMDRMLTQLGVAEGE 480

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F SLD  L  G  L      IFPR++
Sbjct: 481 RTFASLDVPLPAGRALPAP-QGIFPRYV 507


>gi|148553410|ref|YP_001260992.1| methionyl-tRNA synthetase [Sphingomonas wittichii RW1]
 gi|148498600|gb|ABQ66854.1| methionyl-tRNA synthetase [Sphingomonas wittichii RW1]
          Length = 523

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/513 (47%), Positives = 338/513 (65%), Gaps = 10/513 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAI+YPN +PHIGHAYE I AD +ARF R  G DV F TGTDEHG K+A+AA+ 
Sbjct: 7   EPYYITTAISYPNGRPHIGHAYEAIAADAIARFQRSMGRDVRFQTGTDEHGLKMAQAARA 66

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             +T +   D+ S  F++M + L+IS D FIRT++  H+   + +W+ +   GD+Y   Y
Sbjct: 67  RDITPRALADEMSSYFKEMCETLNISCDRFIRTSDADHYAASQAIWQAMEANGDLYLDRY 126

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y++ E+  G  GQ  + Q  PV+W +EE +FFRLS YQ+ LL  Y   P
Sbjct: 127 EGWYSVRDEAFYDEKELTDGEGGQKLSPQGTPVEWTKEESWFFRLSRYQEPLLQLYRDQP 186

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNE++SFV  GL DLS+SR +FDWG+ +P  P ++MYVW+DALTNYLT  GY
Sbjct: 187 DFIRPETRRNEIVSFVSGGLSDLSVSRTSFDWGVPVPGSPGHVMYVWVDALTNYLTGIGY 246

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D  D +  ++WPA+LH+IGKDI+RFH +YWPAFL+SA +PLPK+VF HGF+L+KGEK+S
Sbjct: 247 PDR-DAALGRYWPANLHLIGKDIVRFHTVYWPAFLMSAKIPLPKQVFGHGFLLNKGEKMS 305

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS+GNV+DP+ + E  GVD LRYFL+RE++ G+DG Y  + +  R NA+LAN  GNL  R
Sbjct: 306 KSVGNVVDPMTMAERYGVDQLRYFLLREVSFGQDGSYGHEAIVNRANAELANSFGNLAQR 365

Query: 365 SVSMILKDYDGMIPTPGAFTESDESIL-SVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           ++SMI K+ DG +P     TE D +++ +V +  L E     +       +   +  V  
Sbjct: 366 TLSMIFKNLDGELPALDR-TEDDAALVRAVATACLDETPRAFEQLAFSIGIEAWMKAVFA 424

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            ++Y DAQ PW L+KT+P+R  TVL     VIR LAI +   +P  A K+ D + VA + 
Sbjct: 425 CNQYVDAQAPWTLRKTDPERMKTVLGTLFAVIRDLAITILPIIPDSAGKLLDQMGVAADA 484

Query: 484 RCFQSL------DQRLKPGFMLHKTFDPIFPRF 510
           R F ++      D+    G+ + +   P+FPR 
Sbjct: 485 RDFAAIESQAWYDELRASGYRVAQPV-PLFPRL 516


>gi|58038507|ref|YP_190471.1| methionyl-tRNA synthetase [Gluconobacter oxydans 621H]
 gi|58000921|gb|AAW59815.1| Methionyl-tRNA synthetase [Gluconobacter oxydans 621H]
          Length = 516

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 341/506 (67%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           +  I+T I Y N  PHIGHAY  I ADVLARFHRL+G +VLF +GTDEHGQK+ + A   
Sbjct: 9   RFIITTPIFYVNGAPHIGHAYTSIAADVLARFHRLNGEEVLFVSGTDEHGQKVEQTAVAK 68

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+  + + D+ S +FR M   + IS D+FIRTTE+RH    + LW+K++  G IY G Y 
Sbjct: 69  GMDPQAYADEVSASFRQMQKDMAISTDEFIRTTEERHKGAAKALWEKVAANGHIYLGAYE 128

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWYS RDEA+  +DE+ K  DG +      PV+ ++E  YFFRLS +QD+LL  YE +P+
Sbjct: 129 GWYSTRDEAFIGEDELVKKPDGTFVAPSGAPVERVKEPSYFFRLSDFQDRLLKLYEDNPD 188

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P+  R E+ SFV+ GL+DLS+SR +F WG+ +P+DP ++MYVW DAL NYLT  GY 
Sbjct: 189 FIGPVGPRREIESFVRQGLRDLSVSRTSFKWGVPVPNDPDHVMYVWFDALANYLTAVGYP 248

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  D  +AKFWPAD+H++GK+I RFH +YWPAFL++A + LPK VF+HG+   +GEK+SK
Sbjct: 249 DLND-PRAKFWPADVHIVGKEIARFHCVYWPAFLMAAGIDLPKSVFAHGWWTVEGEKMSK 307

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV+DP  + +E G+DALR+FL+RE+  G D  + +  +  R N +LAN +GNL  R+
Sbjct: 308 SLGNVLDPKALADEFGLDALRFFLMREVPFGGDSNFSRRSMITRTNVELANDLGNLCQRT 367

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S + ++  G++P  G  TE D+++L++ + +   + E ++ + I  AL +V  ++   +
Sbjct: 368 LSQVARNLGGVLPERGTLTEDDQAMLAMVTLLPTIMSEQIERKAITDALEEVWKVIRAAN 427

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW LKKT+P+R + VL V V++IR +A +LQ ++P   +++   L V D+ R 
Sbjct: 428 SYIDRQAPWALKKTDPERMADVLRVLVDMIRGIATMLQPYMPNTMDRMLTQLGVQDDERT 487

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F +L+  L  G  L K  + +FPRF+
Sbjct: 488 FAALETPLPAGRTLPKP-EGLFPRFV 512


>gi|224009692|ref|XP_002293804.1| methionyl-trna synthetase [Thalassiosira pseudonana CCMP1335]
 gi|220970476|gb|EED88813.1| methionyl-trna synthetase [Thalassiosira pseudonana CCMP1335]
          Length = 579

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 245/507 (48%), Positives = 348/507 (68%), Gaps = 10/507 (1%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           I+T I Y N +PHIGHAY  +  DV+AR+ RL G DV F +GTDEHGQK+   A+NA + 
Sbjct: 66  ITTPIYYVNDKPHIGHAYTSLACDVIARYMRLSGRDVFFLSGTDEHGQKVETTAKNANME 125

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
              F D  S +F+++  +L+IS D+FIRTT++ H    + LW  + +KG IY G Y GWY
Sbjct: 126 PLAFCDMVSASFKELLTLLNISNDEFIRTTDEDHKKAVQHLWNVLVEKGAIYLGSYEGWY 185

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWME-EEGYFFRLSAYQDKLLSYYESHPEFI 187
           S+RDE YYN+ E+    DG+        V+W++ E+ YFF+LS YQD+LL+YYE+HP+FI
Sbjct: 186 SVRDECYYNESEL---VDGKAPTGAE--VEWVKKEDSYFFKLSEYQDELLNYYEAHPDFI 240

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  R+NEV+SFVK GLKDLS+SR TFDWG+ +P D  ++MYVWIDALTNY++  GY + 
Sbjct: 241 APESRKNEVVSFVKGGLKDLSISRTTFDWGVPVPGDDDHVMYVWIDALTNYMSALGYPNT 300

Query: 248 -PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
            P G+  KFWPA LHV+GKDILRFHA+YWPAFLL+A +PLPK++F+HG+    GEKISKS
Sbjct: 301 EPGGNFDKFWPASLHVVGKDILRFHAVYWPAFLLAAGIPLPKRIFAHGWWTKDGEKISKS 360

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           LGNVIDP+E+I+  GVD  R+FL+ E+  G DG +  + +  +VNA+L+N +GNL  R +
Sbjct: 361 LGNVIDPVELIDTYGVDPTRFFLMSEVVFGNDGDFSDEKMIYKVNANLSNELGNLNQRIM 420

Query: 367 SMILKDYDGMIPTP-GAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +++ K+ +  +P   G  TE+D+ +L+  + +     E + +Q IH+ +  +IS+V + +
Sbjct: 421 TLVFKNCNKAVPAEIGPLTEADKQLLAKAASLRGITSEAIASQSIHKYVEHMISMVWDAN 480

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
           +Y D Q PW LKKT+ +R +TVLYV +EV+R +AIL Q  +P  +N I D L V ++ R 
Sbjct: 481 KYIDVQAPWVLKKTDTERMNTVLYVLMEVMRHVAILYQPLMPTSSNVILDQLGVPEDERE 540

Query: 486 FQSLDQRLKPGFMLHKTFDP--IFPRF 510
           F+ LD+      +  +   P  +FPRF
Sbjct: 541 FEHLDKEECKIMLGREVGKPHAVFPRF 567


>gi|15604526|ref|NP_221044.1| methionyl-tRNA synthetase [Rickettsia prowazekii str. Madrid E]
 gi|6226189|sp|Q9ZCP0|SYM_RICPR RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|3861220|emb|CAA15120.1| METHIONYL-TRNA SYNTHETASE (metS) [Rickettsia prowazekii]
 gi|292572314|gb|ADE30229.1| Methionyl-tRNA synthetase [Rickettsia prowazekii Rp22]
          Length = 508

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 249/514 (48%), Positives = 342/514 (66%), Gaps = 15/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I Y N   HIGHAY  + +DV+ARF R  G DV+F TGTDEHGQK+ KAA 
Sbjct: 2   KNTYYITTPIYYVNDVAHIGHAYTSVASDVIARFMRFCGKDVMFLTGTDEHGQKVEKAAI 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           N  +  + F D+ S+NFRD+   ++IS DDFIRTTE RH     + WKK+ D G IY+G 
Sbjct: 62  NQNIDPQTFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWKKLLDNGAIYEGF 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWYS+RDEA+Y++ E+    +         PV+W++E  YFF L+ +QDKLL +YE +
Sbjct: 122 YEGWYSVRDEAFYDESEI----NEDKLAPTGAPVEWVKEPSYFFNLAKWQDKLLEFYELN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+ PI RRNEVISF+KSGLKDLS+SR TF WGIK+P++ ++++YVW+DAL NY++  G
Sbjct: 178 PDFVRPISRRNEVISFIKSGLKDLSISRTTFHWGIKVPNNRKHVIYVWLDALVNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D    + AKFWPA+L ++GKDILRFHA+YWPAFL++A +PLPK +  HG+  ++G+KI
Sbjct: 238 YPDK-QSNYAKFWPANLQIVGKDILRFHAVYWPAFLMAAEIPLPKAIMVHGWWTNEGQKI 296

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDPI +I+E GVD +RYFL+RE+  G D  + ++ L  R+N++L+N IGNL+ 
Sbjct: 297 SKSLGNTIDPITLIDEFGVDQVRYFLMREVIFGADANFARNNLITRINSELSNKIGNLLH 356

Query: 364 RSVSMILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           R VS + K+ D  +P    G   +  E  IL    +  QE    M    I++ L  +I+L
Sbjct: 357 RIVSFVYKNNDAKVPLIKSGVIDKIYELPILKTAIKFAQENILLMDKTEINKILENIINL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
             + + Y   + PW LK T+PD+   VLY  +EV+R +AI+LQ FVP  ANK+ D L V+
Sbjct: 417 AEDANIYITNEAPWNLKTTDPDKMLEVLYSLLEVLRYIAIMLQPFVPNSANKMLDQLGVS 476

Query: 481 DENRCFQSL--DQRLKPGFMLHKTFDP--IFPRF 510
            E R F+ L  D  LK G       +P  IFP+F
Sbjct: 477 KEERLFKHLVRDHALKAG---SNILEPSIIFPKF 507


>gi|307292797|ref|ZP_07572643.1| methionyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
 gi|306880863|gb|EFN12079.1| methionyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
          Length = 520

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/510 (47%), Positives = 327/510 (64%), Gaps = 11/510 (2%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           I+TAI+YPN +PHIGHAYE+I  D +ARF R+   DV F TGTDEHG K+A+ A+N G+ 
Sbjct: 7   ITTAISYPNGRPHIGHAYEVIATDAIARFQRMMDRDVFFQTGTDEHGLKMAQTARNRGIE 66

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
            +   D+ S  F+ M D L+ISYD FIRT+E  HH   + +W+ +   GD+Y G Y GWY
Sbjct: 67  PRELADEMSSYFKAMNDGLNISYDRFIRTSEPDHHSASQAIWQAMEANGDLYLGRYEGWY 126

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFIL 188
           S+RDEA+Y++ E+ +G  GQ  + Q  PV+W  EE +FFRLSAYQ KLL  Y   P+FI 
Sbjct: 127 SVRDEAFYDEKELTEGEGGQKLSPQGTPVEWTVEESWFFRLSAYQQKLLDLYTGQPDFIQ 186

Query: 189 PIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNP 248
           P  RRNE++ FV+ GL DLS+SR +FDWG+K+P    ++MYVW+DALTNYLT  GY D+ 
Sbjct: 187 PDSRRNEIMRFVEGGLSDLSVSRTSFDWGVKVPGSDGHVMYVWVDALTNYLTGCGYPDDL 246

Query: 249 DGSKAKFWPAD---LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           +   A++W       HVIGKDI+RFH +YWPAFL+SA LPLPK+VF HGF+L++GEK+SK
Sbjct: 247 E-RMARYWAEGGDITHVIGKDIVRFHTVYWPAFLMSAKLPLPKQVFGHGFLLNRGEKMSK 305

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV DP+E+ E  GVD LRYFL+ E+  G DG Y  + +  R N+DLAN  GNL  R+
Sbjct: 306 SLGNVADPMELAERFGVDQLRYFLLSEVTFGNDGSYSAEAIVTRSNSDLANSFGNLAQRT 365

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I K+ +G +P P A  E D  +L   +   Q  +  M +     A+   +  V   +
Sbjct: 366 LSFIAKNLEGRLPEP-APQEVDGDLLKTVAEAAQTFQAAMVDLAPSTAIEAWMRAVFACN 424

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y DAQ PW L+KT+P R   VL    E I  LAI++Q  +P  A+ + D + VA E R 
Sbjct: 425 AYIDAQAPWTLRKTDPARMEAVLATLYEAIAHLAIIVQPVIPASASALLDQMGVAGEGRN 484

Query: 486 FQSLDQRL-----KPGFMLHKTFDPIFPRF 510
           + ++           GF+L     P+FPR 
Sbjct: 485 YAAIGSGWYAALRASGFVLGAP-KPLFPRL 513


>gi|85708668|ref|ZP_01039734.1| methionine--tRNA ligase [Erythrobacter sp. NAP1]
 gi|85690202|gb|EAQ30205.1| methionine--tRNA ligase [Erythrobacter sp. NAP1]
          Length = 525

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 251/515 (48%), Positives = 333/515 (64%), Gaps = 11/515 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E    YI+TAI YPN +PHIGHAYE I ADV+ARF RL G +V F TGTDEHG K+A+ A
Sbjct: 5   ENAPYYITTAINYPNGRPHIGHAYEGIAADVIARFQRLKGREVRFQTGTDEHGLKMARKA 64

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  G T +   D+ S  FR+M + L+I +D FIRT E  HH   + +W+++   GD+Y  
Sbjct: 65  EEQGRTPRDLADEMSGYFREMDEALNIDFDRFIRTVEPEHHRASQAIWERMEAAGDLYLD 124

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWYS+RDEAYY++ E+ +G   Q  + Q  PV+W  EE +FFRLS Y+  LL   ++
Sbjct: 125 RYEGWYSVRDEAYYDESELVEGEGEQKLSPQGTPVEWTVEESWFFRLSKYEKPLLDLLKT 184

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
            P F+ P  RRNE+I+FV+ GL+DLS+SR +FDWG+K+P    ++MYVW+DALTNYLT  
Sbjct: 185 -PGFLEPASRRNEMIAFVEQGLRDLSVSRTSFDWGVKVPGSDNHVMYVWVDALTNYLTGL 243

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           G+ D       KFWPA LH+IGKDI+RFH IYWPAFL+SANLP+PKKVF HGF+L++G+K
Sbjct: 244 GFPDE-TPEMEKFWPASLHLIGKDIVRFHTIYWPAFLMSANLPVPKKVFGHGFLLNRGQK 302

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
            SKSLGNV DP+E+ E+ GVD LRYFL+RE+A G+DG Y  + +  R NA+LAN  GNL 
Sbjct: 303 ESKSLGNVTDPLELAEQFGVDNLRYFLMREVAFGQDGSYSSEAIVTRTNAELANSFGNLA 362

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV-ISLV 421
            R++SMI K+ DG++  P    E D ++L+               QL      +V I  V
Sbjct: 363 QRTLSMIAKNMDGVL-EPFELAEVDTALLAAVKNACATDLPREFEQLAFSVGIEVWIKAV 421

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
              ++Y D Q PW LKKT+P+R   VL      IR LAI +Q  VP+ A+ + D L V +
Sbjct: 422 YACNQYVDEQAPWTLKKTDPERMKAVLQTLFCAIRDLAIAIQPIVPEKASAVLDQLGVPE 481

Query: 482 ENRCFQSL------DQRLKPGFMLHKTFDPIFPRF 510
             R F+ L      D+  K G ++ K   PIFPR 
Sbjct: 482 NERQFEQLHDRSWFDRLAKSGHVVGKP-TPIFPRL 515


>gi|296116331|ref|ZP_06834947.1| methionyl-tRNA synthetase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977150|gb|EFG83912.1| methionyl-tRNA synthetase [Gluconacetobacter hansenii ATCC 23769]
          Length = 512

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 238/506 (47%), Positives = 331/506 (65%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T I Y N  PHIGHAY  + ADV+ARF RL G DV F TGTDEHGQK+ +AA  A
Sbjct: 4   RYYVTTPIYYVNGAPHIGHAYTSVAADVIARFKRLAGFDVFFLTGTDEHGQKVEQAAHTA 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           GVT     ++ + +FRDM D + ISYDDFIRTT+ RH +    LWKK+ + G IY G Y 
Sbjct: 64  GVTPIELANRVAADFRDMYDKMAISYDDFIRTTQPRHAEGAAALWKKLEENGHIYLGAYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY+LRDE +Y ++E+   ADG        PV+W++E  YFFRLS +QD+LL  YE+HP 
Sbjct: 124 GWYALRDECFYQEEELVIAADGTRTAPTGAPVEWVKEPSYFFRLSKFQDRLLELYETHPG 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNEV SFV+ GL+DLS+SR +F+WGI +P DP+++MYVW+DAL NYL+  GY 
Sbjct: 184 FVEPAGRRNEVRSFVRGGLRDLSISRTSFNWGIPVPGDPKHVMYVWVDALANYLSAVGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D     +  FWPA+LH++GKDILRFHAIYWPA L+ A LPLP++VFSHG+    G+K+SK
Sbjct: 244 DE-GAPRWDFWPANLHLVGKDILRFHAIYWPALLMGAGLPLPERVFSHGWWTIAGQKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV+DP +++ E G+D +R+FL+RE+  G D   ++  +  R+N +LAN +GNL  R+
Sbjct: 303 SLGNVLDPRDLVAEFGLDPVRFFLMREMPFGGDSDINRKAIITRMNVELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I ++  G++P     T  D ++L+  S +   +   +  Q +  AL +V  ++   +
Sbjct: 363 LSQIARNCAGLLPERATPTAEDTALLAQASLLPDLMHGQIDRQALTDALEEVWKVIRASN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW LKKT+P R + VL V  +V+R +A +LQ ++P   + +   L V    R 
Sbjct: 423 AYIDHQAPWALKKTDPQRMADVLRVLADVLRTIATVLQPYMPGSMDTMLTQLGVEATERD 482

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F +L   L  G  L      IFPRF+
Sbjct: 483 FAALGTPLPAGRPLPAP-KGIFPRFV 507


>gi|157804069|ref|YP_001492618.1| methionyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
 gi|157785332|gb|ABV73833.1| methionyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
          Length = 510

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/508 (48%), Positives = 342/508 (67%), Gaps = 13/508 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I Y N  PHIGHAY  +++DV+ARF RL G +V+  TGTDEHGQK+ KAA N  +
Sbjct: 6   YITTPIYYVNNVPHIGHAYTSVVSDVIARFMRLCGFEVILLTGTDEHGQKVEKAAINKNI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F DQ S NFR +   + IS DDFIRTTE RH +   + W+K+ D G IYKG Y GW
Sbjct: 66  DPQQFTDQISENFRHLMTSMHISNDDFIRTTENRHKEAVAVFWQKLLDNGTIYKGFYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y++RDEA+Y++ E+   +DG         V+W++E  YFF LS +QDKLL  YE +P+FI
Sbjct: 126 YAVRDEAFYDESEL--TSDGLAPTGAS--VEWVKEPSYFFNLSKWQDKLLELYELNPDFI 181

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            PI RRNEVI+FVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  GY D 
Sbjct: 182 RPISRRNEVINFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYPDE 241

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
              +  KFWPA LHV+GKDILRFHA+YWPAFL++A +PLPK + +HG+  ++G+KISKSL
Sbjct: 242 -QSNYGKFWPAALHVVGKDILRFHAVYWPAFLMAAKIPLPKTIMAHGWWTNEGQKISKSL 300

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN IDPI++I+E GVD +RYFL+RE+  G DG + +  L  R+N++L+N IGNL+ R+ +
Sbjct: 301 GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTA 360

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIREN---MQNQLIHRALAQVISLVSEV 424
            + K+ DG +P            L +    ++   +N   M+   +++ L  +I+L  E 
Sbjct: 361 FVYKNNDGKVPLLTQSVIDKIYTLPILKAAIKCAEQNILLMEKTEVNKILENIINLAEEA 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D + PW LKKT+ D+   VLY  +EV+R +AI+LQ FVP  ANK+ D L V  + R
Sbjct: 421 NIYIDNKAPWNLKKTDHDKMLEVLYALLEVLRYIAIMLQPFVPTSANKMLDQLGVNKKER 480

Query: 485 CFQSL--DQRLKPG-FMLHKTFDPIFPR 509
            F+ L  D  L  G  +L  T   IFPR
Sbjct: 481 LFKHLVRDYALTVGAAILEPTI--IFPR 506


>gi|94496391|ref|ZP_01302968.1| methionyl-tRNA synthetase [Sphingomonas sp. SKA58]
 gi|94424137|gb|EAT09161.1| methionyl-tRNA synthetase [Sphingomonas sp. SKA58]
          Length = 520

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 238/510 (46%), Positives = 332/510 (65%), Gaps = 11/510 (2%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           I+TAI+YPN +PHIGHAYE+I  D +ARF R+ G DV F TGTDEHG K+A+ A+  G+ 
Sbjct: 7   ITTAISYPNGRPHIGHAYEVIATDAIARFQRMMGRDVFFQTGTDEHGLKMAQTARARGIE 66

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
            +   D+ +  F+ M + L+IS+D FIRT+E  HH   + +W+ +   GD+Y G Y GWY
Sbjct: 67  PRALADEMAGYFKVMNEALNISHDRFIRTSEPDHHRASQAIWRAMEANGDLYLGRYEGWY 126

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFIL 188
           S+RDEA+Y++ E+ +G  G   + Q+ PV+W  EE +FFRLSAYQDKLL+ YES P+FI 
Sbjct: 127 SVRDEAFYDEKELIEGEGGAKLSPQNTPVEWTVEESWFFRLSAYQDKLLALYESQPDFIQ 186

Query: 189 PIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNP 248
           P  RRNE++ FV+ GL DLS+SR +FDWG+++PD   ++MYVW+DALTNYLT  GY D+ 
Sbjct: 187 PESRRNEIMRFVEGGLSDLSISRTSFDWGVRVPDADGHVMYVWVDALTNYLTGCGYPDDA 246

Query: 249 DGSKAKFWPAD---LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           +   A++W       HVIGKDI+RFHA+YWPAFL+SA LPLPK++F HGF+L++GEK+SK
Sbjct: 247 E-RMARYWAEGGDITHVIGKDIVRFHAVYWPAFLMSAKLPLPKQIFGHGFLLNRGEKMSK 305

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV DP+E+ +  GVD LRYFL+ E+  G DG Y  + +  R N+DLAN  GNL  R+
Sbjct: 306 SLGNVADPMELADRFGVDQLRYFLLSEVTFGNDGSYSAEAIIARSNSDLANSFGNLAQRT 365

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I K+ DG +P P A  E D ++LS  +   +  +  M +     A+   +  V   +
Sbjct: 366 LSFIAKNLDGRLPEPAAM-EVDSALLSGIADACRIFQNAMNDLAPSVAIEAWMRAVFACN 424

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y DAQ PW L+KT+P R   VL    E I  LA+++Q  +P  A  + D + +  + R 
Sbjct: 425 AYIDAQAPWALRKTDPARMEAVLATLYEAIASLAVMIQPVIPASAAALLDQMGIDADARS 484

Query: 486 FQSLDQRL-----KPGFMLHKTFDPIFPRF 510
           ++ +           GF L     P+FPR 
Sbjct: 485 YELIGSDFYAALRASGFALSPP-KPLFPRL 513


>gi|296535550|ref|ZP_06897732.1| methionine--tRNA ligase [Roseomonas cervicalis ATCC 49957]
 gi|296264136|gb|EFH10579.1| methionine--tRNA ligase [Roseomonas cervicalis ATCC 49957]
          Length = 522

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/519 (47%), Positives = 344/519 (66%), Gaps = 17/519 (3%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M    + Y++T I Y N +PHIGHAY  + ADVLAR+ R+ G  V F TGTDEHGQK+ K
Sbjct: 1   MTSERRFYLTTPIYYVNDKPHIGHAYTSLAADVLARWKRMMGHQVHFLTGTDEHGQKVEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+  + F DQ S+ FRD+A  ++ S DDFIRTTE+RH   C  LWK++ ++G+I+
Sbjct: 61  AAEARGMAPQDFTDQVSQAFRDLAVRMNYSNDDFIRTTEERHKLACAALWKRLEERGEIH 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
            G Y GWY++RDEA+Y  DE+ +  DGQ +     PV+W+ E  YFFRLS +Q+KLL +Y
Sbjct: 121 LGHYEGWYAVRDEAFYGPDEITE-KDGQKFAPTGAPVEWVREPSYFFRLSNWQEKLLEFY 179

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E++P+FI P  RRNEVISFVKSGL DLS+SR +F WG+K+P D  ++MYVW+DALTNY+T
Sbjct: 180 EANPDFIAPASRRNEVISFVKSGLTDLSISRTSFKWGVKVPGDEAHVMYVWLDALTNYIT 239

Query: 241 TTGYLDNPDGSKA--KFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
             GY   PD S A   FWPAD+H +GKDILRFHAIYWPAFL++A LP P++VF+HG+  +
Sbjct: 240 ALGY---PDESAANWSFWPADVHFVGKDILRFHAIYWPAFLMAAGLPTPRRVFAHGWWTN 296

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           +G+KISKSLGNVIDP+ +IEE G+D +RYFL+RE+  G DG + +  L  R+N +LA+ +
Sbjct: 297 EGQKISKSLGNVIDPLALIEEFGLDPVRYFLLREVPFGSDGDFQRKALAARLNGELADAL 356

Query: 359 GNLVSRSVSMILKDYDGMIPTP-GAFTESDESILSVCS---------RVLQEIRENMQNQ 408
           GNL +R++S+I ++ +G++P P G   E+D + L+             +  ++   +  Q
Sbjct: 357 GNLANRTLSLIQRNCEGVLPEPAGTEAEADRAFLAETGLEIGADGTLALAAKVDALLNEQ 416

Query: 409 LIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPK 468
               AL+ V + + E + Y   ++PW LKKT+  R   VL    + +R  A LL+ F+P+
Sbjct: 417 KFDAALSLVFASIREANGYITREQPWALKKTDLARMRVVLRRLHDALRAFATLLEPFMPE 476

Query: 469 LANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIF 507
              K+ D L V  E R   +L   L PG +      P+F
Sbjct: 477 SMAKLLDQLGVPAEARSVAALATAL-PGGIALPPPSPLF 514


>gi|114327741|ref|YP_744898.1| methionyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
 gi|114315915|gb|ABI61975.1| methionyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
          Length = 514

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/509 (46%), Positives = 333/509 (65%), Gaps = 5/509 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y +T I Y N  PHIGHAY  +  DVLAR+ RL+G +V F TGTDEHGQK+ KAA +A
Sbjct: 4   RYYCTTPIYYVNGAPHIGHAYTCVATDVLARWKRLEGREVFFLTGTDEHGQKVEKAAADA 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           GV  + F+D  +  FR MA+ ++ S+D FIRTTE  H      LW ++ ++G+IY G Y 
Sbjct: 64  GVDPQTFIDGMADGFRAMAEKMNTSHDRFIRTTEPEHKKAVAALWSRLEERGEIYLGSYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY++RDEA+Y +DE+    DG+ Y     PV+ + E  YFFRLS + D LL  YE  P+
Sbjct: 124 GWYAVRDEAFYGEDELTLKPDGKRYAPTGAPVERVTEPSYFFRLSRWGDALLKLYEDQPD 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNEVISFVK GL DLS+SR +F WG+ +P D ++++YVW+DALTNYLT  GY 
Sbjct: 184 FIAPQARRNEVISFVKQGLTDLSISRTSFSWGVPVPGDAKHVVYVWLDALTNYLTAVGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D        FWPADLH++GKDILRFHAI+WPAFL++A LPLP++VF+HG+   +GEK+SK
Sbjct: 244 DE-TSPAWPFWPADLHMVGKDILRFHAIFWPAFLMAAGLPLPRRVFAHGWWTVEGEKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGN I+P  +++E G+D +R+FL+RE+  G DG + +  +  R+N +LAN +GNL  R+
Sbjct: 303 SLGNTIEPGALVDEFGLDPVRFFLLREVPFGNDGDFSRRAMIGRMNTELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S+I ++ DG +P  GA T  D ++L   + +  ++   +  Q  H AL +   ++   +
Sbjct: 363 LSLIARNCDGALPARGAETGEDATLLRDAASLPAKMGAQIDRQAFHEALEEAWKVIRAAN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV---ADE 482
            Y D Q PW LKKT+PDR   VL V  +V+R +A ++Q FVP  A ++   L V   A E
Sbjct: 423 GYIDRQAPWALKKTDPDRMRDVLRVLADVLRIIATVMQPFVPGSAARMLVQLGVREAAGE 482

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
              F +L+  L+ G  L      IFPRF+
Sbjct: 483 QVPFAALETHLEEGTRLPAP-QGIFPRFV 510


>gi|162147584|ref|YP_001602045.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542217|ref|YP_002274446.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786161|emb|CAP55743.1| Methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529894|gb|ACI49831.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 512

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 238/508 (46%), Positives = 334/508 (65%), Gaps = 6/508 (1%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T I Y N  PHIGHAY  + AD++ARF RL G DV F TGTDEHGQK+ +AAQ A
Sbjct: 4   RYYVTTPIYYVNGAPHIGHAYTSVAADIVARFKRLAGFDVFFLTGTDEHGQKVEQAAQAA 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+    F D+ S +FR M DV+++SYDDFIRTTE RH      LW++I+  G IY G Y 
Sbjct: 64  GLAPIAFADRVSADFRAMYDVMNVSYDDFIRTTEPRHIAGATALWERIAANGHIYLGAYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY+LRDE++YN+DE+    DG        PV+W+ E  YFFRLSA+ D+LL  YE+ P 
Sbjct: 124 GWYALRDESFYNEDELVTQPDGTRVAPTGAPVEWVREPSYFFRLSAFADRLLDLYETRPG 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNEV SFV+ GL+DLS+SR +F WGI +P D  ++MYVW+DAL NYL+  G+ 
Sbjct: 184 FVEPASRRNEVASFVRQGLRDLSISRTSFRWGIPVPGDADHVMYVWVDALANYLSAIGFP 243

Query: 246 D--NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           D  NP   +A FWPA+LH++GKDI+RFHAIYWPA L++A L LP  VFSHG+   +GEK+
Sbjct: 244 DARNP---RAGFWPANLHLVGKDIVRFHAIYWPALLMAAGLDLPDCVFSHGWWTIEGEKM 300

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGNV+DP +++ E G+D +R+FL+RE+  G D    +  +  R+N +LAN +GNL  
Sbjct: 301 SKSLGNVVDPRDLVAEFGLDPVRFFLMREMPFGGDSDLSRKAIINRMNVELANDLGNLAQ 360

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R++S + ++  G++P  G  T+ D ++L+    +   + E +  + +  AL +V  ++  
Sbjct: 361 RTLSQVARNCGGLLPEQGTRTDDDIALLAQADLLPTLMHEQIDRRALTDALEEVWRVIRA 420

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
            + Y D Q PW LKKT+PDR + VL V V+ +R +  +LQ ++P   + +   L VA++ 
Sbjct: 421 CNAYIDRQAPWALKKTDPDRMAVVLRVLVDALRGIGTMLQPYMPGSMDALLTQLGVAEDE 480

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           R F SL   L PG         IFPR++
Sbjct: 481 RDFASLATPL-PGGRALPPPQGIFPRYV 507


>gi|326387756|ref|ZP_08209362.1| methionyl-tRNA synthetase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207802|gb|EGD58613.1| methionyl-tRNA synthetase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 541

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 250/520 (48%), Positives = 337/520 (64%), Gaps = 20/520 (3%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAI+YPN +PHIGHAYE I ADV+ RF R  G D    TGTDEHG K+A+ A++
Sbjct: 14  EPYYITTAISYPNGKPHIGHAYEAIAADVIVRFMRAMGRDARLQTGTDEHGLKMAQKARD 73

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T K   DQ S+ F+DM   L++ YD FIRTTE RHH+  + LW+++   GD+Y   Y
Sbjct: 74  LGLTAKELADQMSQYFKDMCAALNVGYDVFIRTTEDRHHEASQELWRRMKANGDLYLDRY 133

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEAYY++ E+  G  GQ  + Q  PV+W  EE +FFRLSAY DKLL+ Y  +P
Sbjct: 134 EGWYSIRDEAYYDESELVAGEGGQKLSPQGTPVEWTVEESWFFRLSAYGDKLLTLYNENP 193

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIP--------DDPQYIMYVWIDALT 236
           EFI P  RRNE++ FV+ GL+DLS+SR +FDWGIK+P        DD  ++MYVW+DALT
Sbjct: 194 EFIRPESRRNEIMRFVEGGLRDLSVSRTSFDWGIKVPVHGEGETSDD--HVMYVWVDALT 251

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NYLT  G+ +  +  + KFWPA+LH+IGKDI+RFH +YWPAFL+SA LP+P++VF HGF+
Sbjct: 252 NYLTGLGWPEETEEFR-KFWPANLHLIGKDIIRFHTVYWPAFLMSAGLPVPRQVFGHGFL 310

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L++G+K SKSLGNV DP+++    GVD LRYF +RE+  G+DG Y  + +  R NA+LAN
Sbjct: 311 LNRGQKESKSLGNVTDPLDLAARFGVDPLRYFFLREVVFGQDGSYSPEAIATRCNAELAN 370

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQE-IRENMQNQLIHRALA 415
             GNLV R++SMI K+  G + T  + TE+DE++L+  +   +E +    +       L 
Sbjct: 371 SYGNLVQRTLSMIFKNCGGELATFSS-TEADEALLATVAAATREDLPREFEALNFSAGLE 429

Query: 416 QVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
             +  V   + Y D Q PW L+KT+P+R   VLY     IR L I +Q  VP  A K+ D
Sbjct: 430 AWMRAVFACNAYVDEQAPWALRKTDPERMRAVLYTLFMAIRDLTIAIQPVVPATAAKVLD 489

Query: 476 ILFVADENRCFQSLDQ------RLKPGFMLHKTFDPIFPR 509
            L V ++ R    L +      R+  G  L     P FPR
Sbjct: 490 QLGVPEDQRGIADLPRADWYMARVATGERLAAPV-PAFPR 528


>gi|87199956|ref|YP_497213.1| methionyl-tRNA synthetase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135637|gb|ABD26379.1| methionyl-tRNA synthetase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 521

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/512 (47%), Positives = 331/512 (64%), Gaps = 8/512 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAI+YPN +PHIGHAYE I ADV+ARF R  G DV F TGTDEHG K+A+ A+ 
Sbjct: 3   EPFYITTAISYPNGKPHIGHAYEAIAADVIARFQRAMGRDVRFQTGTDEHGLKMAQKARE 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T +   D+ S  F  M D L++SYD FIRTTE+RHH + + LW+++   GD+Y   Y
Sbjct: 63  LGITPRELSDEMSSYFIKMCDELNVSYDVFIRTTEERHHASTQELWRRMEANGDLYLDRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEA+Y++ E+  G  G+  + Q  PV W  EE +FFRLS Y + LL  YE +P
Sbjct: 123 EGWYSVRDEAFYDESELVAGEGGEKLSPQGTPVDWTVEESWFFRLSKYAEPLLKLYEENP 182

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
            FI P  RRNEV+ FV+ GL+DLS+SR +FDWG+K+P    ++MYVW+DALTNY+T  G+
Sbjct: 183 GFIQPDSRRNEVMRFVEGGLRDLSVSRTSFDWGVKVPGCDGHVMYVWVDALTNYITGLGF 242

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D  +G  AK+WPA+LH+IGKDI+RFH +YWPAFL+SA++ LP++VF HGF+L++G+K S
Sbjct: 243 PDE-NGDFAKYWPANLHLIGKDIVRFHTVYWPAFLMSADIALPRQVFGHGFLLNRGQKES 301

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGNV DP+++ +  GVD LRYFL+RE+A G+DG Y  + +  R NA+LAN  GNLV R
Sbjct: 302 KSLGNVTDPLDLADRFGVDPLRYFLMREVAFGQDGSYSAEAIVTRCNAELANSYGNLVQR 361

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++SMI K+  G + T  +    DE + +V +   +E+            +   +  V   
Sbjct: 362 TLSMIFKNMGGNLETFHSNVGDDELLATVFNACREELPREFSALNFSAGIEAWMRAVFAC 421

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           + Y D Q PW L+KT+P+R   VL      IR L + +   VP  A K+ D L +  E R
Sbjct: 422 NAYVDEQAPWALRKTDPERMKAVLLTLFIAIRDLTVAISPVVPAAAAKVLDQLGIPREAR 481

Query: 485 CFQSLD------QRLKPGFMLHKTFDPIFPRF 510
            F +L        R+  G  L +   P FPR 
Sbjct: 482 GFDALTDADWYMARVATGERLAQPM-PAFPRL 512


>gi|289704778|ref|ZP_06501199.1| methionine--tRNA ligase [Micrococcus luteus SK58]
 gi|289558494|gb|EFD51764.1| methionine--tRNA ligase [Micrococcus luteus SK58]
          Length = 541

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 249/531 (46%), Positives = 334/531 (62%), Gaps = 26/531 (4%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   Y++TAI+YPN +PHIGHAYE I +D +ARF RLDG DV F TGTDEHGQK+ + AQ
Sbjct: 5   RAPYYLTTAISYPNGEPHIGHAYEYIASDAMARFQRLDGRDVRFLTGTDEHGQKMEQTAQ 64

Query: 64  NAGVTTKVFVDQNSRNFRDMAD-VLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
             GV+      +N+  FR+M D VLDISYD FIRTT+  H +  R +W+++   GDIY G
Sbjct: 65  QQGVSALELATRNAAVFREMDDDVLDISYDRFIRTTDTDHAEAVREIWRRMEANGDIYLG 124

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYE 181
            Y+GWYS+RDE Y+ +DE   G DG     +    V W EEE YFFRLS YQ  LL +Y 
Sbjct: 125 SYAGWYSVRDERYFGEDETEVGQDGVRRAVETGTEVTWTEEESYFFRLSKYQQPLLDHYR 184

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQ-----------YIMYV 230
            HP+F  P  R NEVI FV++GL+DLS+SR +F WGI +P               ++ YV
Sbjct: 185 EHPDFAAPRYRFNEVIRFVEAGLEDLSISRTSFQWGIDLPAPADPDAADADRRADHVTYV 244

Query: 231 WIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKV 290
           W+DALTNYLT  G+      + A++WPADLHVIGKDI RFH I+WPAFL+SA L LP++V
Sbjct: 245 WVDALTNYLTGAGWPAEDPEAFARYWPADLHVIGKDISRFHCIFWPAFLMSAGLELPRRV 304

Query: 291 FSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRV 350
             HGF+ + G K+SKSLGNV+ P E +   G+DA+R+FL+RE   G DG Y  + +  R 
Sbjct: 305 MIHGFLNNNGAKMSKSLGNVVHPREWVARYGLDAIRFFLLREFPFGADGSYSHEAVVSRK 364

Query: 351 NADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLI 410
           NADLAN +GNL  RS+SM+ K+    +P PG  T++D ++L+    +L+  R     Q  
Sbjct: 365 NADLANNLGNLAQRSLSMVAKNCGAAVPEPGELTDADRAVLAQVDALLERSRSAYAVQDF 424

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           H AL +   ++ EV+ YF  Q PW L+KT+  R  TVLYVT++ +R++A+L Q  +P  A
Sbjct: 425 HDALEETWRVLGEVNAYFADQAPWVLRKTDEPRMRTVLYVTLQAVRRVALLAQPVMPDSA 484

Query: 471 NKIFDILFVADEN------------RCFQSLDQRLKPGFMLHKTFDPIFPR 509
           +++ D+L V  E             R F +  + L PG  L     P+FPR
Sbjct: 485 SRLLDLLGVPAEGDAGRTGASGTGPRSFAAFHEDLVPGTPLPAP-QPVFPR 534


>gi|294011648|ref|YP_003545108.1| methionyl-tRNA synthetase [Sphingobium japonicum UT26S]
 gi|292674978|dbj|BAI96496.1| methionyl-tRNA synthetase [Sphingobium japonicum UT26S]
          Length = 520

 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 329/510 (64%), Gaps = 11/510 (2%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           I+TAI+YPN +PHIGHAYE+I  D +ARF R+ G DV F TGTDEHG K+A+ A++  + 
Sbjct: 7   ITTAISYPNGRPHIGHAYEVIATDAIARFQRMMGRDVFFQTGTDEHGLKMAQTARSRDME 66

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
            +   D+ S  FR M D L+ISYD FIRT+E  HH   + +W+ +   GD+Y G Y GWY
Sbjct: 67  PRALADEMSGYFRAMNDGLNISYDRFIRTSEPDHHRASQAIWQAMEANGDLYLGRYEGWY 126

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFIL 188
           S+RDEA+Y++ E+ +G  GQ  + Q  PV+W  EE +FFRLSAYQ KLL  Y + P+FI 
Sbjct: 127 SVRDEAFYDEKELTEGEGGQKLSPQGTPVEWTVEESWFFRLSAYQQKLLDLYANQPDFIQ 186

Query: 189 PIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNP 248
           P  RRNE++ FV+ GL DLS+SR +FDWG+K+P    ++MYVW+DALTNY+T  GY D+ 
Sbjct: 187 PDSRRNEIMRFVEGGLSDLSVSRTSFDWGVKVPGSDGHVMYVWVDALTNYITGCGYPDDT 246

Query: 249 DGSKAKFWPAD---LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           +   A++W       H+IGKDI+RFH +YWPAFL+SA LPLPK+VF HGF+L++GEK+SK
Sbjct: 247 E-RMARYWSEGGDITHIIGKDIVRFHTVYWPAFLMSAKLPLPKQVFGHGFLLNRGEKMSK 305

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGNV DP+E+ E  GVD LRYFL+ E+  G DG Y  + +  R N+DLAN  GNL  R+
Sbjct: 306 SLGNVADPMELAERFGVDQLRYFLLSEVTFGNDGSYSAEAIVARSNSDLANSFGNLAQRT 365

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I K+ +G +P   A  + D  +L+      +  +  M +     A+   +  V   +
Sbjct: 366 LSFIAKNLEGRLPETAA-QDVDRDLLATVGEAARTFQAAMADLAPSTAIEAWMRAVFACN 424

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y DAQ PW L+KT+P R   VL    E I  LAI++Q  +P  A  + + + +A++ R 
Sbjct: 425 AYIDAQAPWTLRKTDPARMEAVLATLYEAIADLAIVIQPIIPASAAALLEQMGIAEDGRS 484

Query: 486 FQSLDQ----RLKP-GFMLHKTFDPIFPRF 510
           + ++      RL+  GF L     P+FPR 
Sbjct: 485 YAAIGSDWYARLRASGFTLSAP-KPLFPRL 513


>gi|190570583|ref|YP_001974941.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190356855|emb|CAQ54226.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 509

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 250/513 (48%), Positives = 344/513 (67%), Gaps = 9/513 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T I Y N +PHIGHAY  +I DV ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFESFYITTPIYYVNDKPHIGHAYTSLICDVAARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+  K F D+ S  FR +A++++  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKTKGIEPKEFTDEISVTFRKLAELMNFDYDDFIRTTEERHEKAVIALWNRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEA+Y + E+  G            VQW++EE YFFRLS++Q+KLL  Y
Sbjct: 121 LDSYSGWYSVRDEAFYQESELIYGR-----APTGAEVQWIKEESYFFRLSSWQNKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E+ P FI P  R+NEV+SFVKSGL DLS+SR +F+WGIK+P++ ++++YVWIDALTNYLT
Sbjct: 176 ENQPNFIFPESRKNEVVSFVKSGLTDLSISRTSFNWGIKVPENDKHVIYVWIDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFWPA--DLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           + G+ +  D    KFW    ++HVIGKDILRFHA+YWPA LL+A+LPLPK++  HG+ L+
Sbjct: 236 SIGFPNIEDEEYKKFWTNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLN 295

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           +GEKISKSLGNVIDPI + EE GVD LRYFL+RE + G+DG + K  +  R+N++LAN I
Sbjct: 296 EGEKISKSLGNVIDPINLAEEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNI 355

Query: 359 GNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           GNLV R++S + K   G++P        D+  L  C  ++ ++ +++     ++ +  +I
Sbjct: 356 GNLVQRTISFLHKQCFGVVPVVDRNLLKDDESLPNCKAIIDQVMDHLSKYEFNQIILLII 415

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++ S+ + Y D   PW L KT+ +R   V+Y  +E IR + ILLQ  VPK A  I D L 
Sbjct: 416 NISSKANAYIDKSAPWTLSKTDRERMDLVIYKLLEYIRMIGILLQPIVPKSAKMILDQLQ 475

Query: 479 VADENRCFQSL-DQRLKPGFMLHKTFDPIFPRF 510
           +  E R  +SL +  +  G  L K   PIF RF
Sbjct: 476 IPKEQRDLKSLCNACVSLGITLPKP-TPIFLRF 507


>gi|239917380|ref|YP_002956938.1| methionyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
 gi|281414136|ref|ZP_06245878.1| methionyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
 gi|239838587|gb|ACS30384.1| methionyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
          Length = 541

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 249/531 (46%), Positives = 332/531 (62%), Gaps = 26/531 (4%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R   Y++TAI+YPN +PHIGHAYE I  D +ARF RLDG DV F TGTDEHGQK+ + AQ
Sbjct: 5   RAPYYLTTAISYPNGEPHIGHAYEYIATDAMARFQRLDGRDVRFLTGTDEHGQKMEQTAQ 64

Query: 64  NAGVTTKVFVDQNSRNFRDMAD-VLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
             GV+      +N+  F++M D VLDISYD FIRTT+  H +  R +W+++   GDIY G
Sbjct: 65  QQGVSALELATRNAAVFKEMDDDVLDISYDRFIRTTDTDHAEAVREIWRRMEANGDIYLG 124

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-VQWMEEEGYFFRLSAYQDKLLSYYE 181
            Y+GWYS+RDE Y+ +DE   G DG     +    V W EEE YFFRLS YQ  LL +Y 
Sbjct: 125 SYAGWYSVRDERYFGEDETEVGQDGVRRAVETGTEVTWTEEESYFFRLSKYQQPLLDHYR 184

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDD-----------PQYIMYV 230
            HP+F  P  R NEVI FV++GL+DLS+SR +F WGI +P               ++ YV
Sbjct: 185 DHPDFAAPRYRFNEVIRFVEAGLEDLSISRTSFQWGIDLPAPADPEAADADRRADHVTYV 244

Query: 231 WIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKV 290
           W+DALTNYLT  G+      + A++WPADLHVIGKDI RFH I+WPAFL+SA L LP +V
Sbjct: 245 WVDALTNYLTGAGWPAGDPEAFARYWPADLHVIGKDISRFHCIFWPAFLMSAGLELPHRV 304

Query: 291 FSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRV 350
             HGF+ + G K+SKSLGNV+ P E +   G+DA+R+FL+RE   G DG Y  + +  R 
Sbjct: 305 MIHGFLNNNGAKMSKSLGNVVHPREWVARYGLDAIRFFLLREFPFGADGSYSHEAVVSRK 364

Query: 351 NADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLI 410
           NADLAN +GNL  RS+SM+ K+    +P PG  TE+D ++L+    +L+  R     Q  
Sbjct: 365 NADLANNLGNLAQRSLSMVAKNCGAAVPEPGELTEADRAVLAQVDALLERSRSAYAVQDF 424

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           H AL +   ++ EV+ YF  Q PW L+KT+  R  TVLYVT++ +R++A+L Q  +P  A
Sbjct: 425 HDALEETWRVLGEVNAYFADQAPWVLRKTDEPRMRTVLYVTLQAVRRVALLAQPVMPDSA 484

Query: 471 NKIFDILFVADEN------------RCFQSLDQRLKPGFMLHKTFDPIFPR 509
           +++ D+L V  E             R F +  + L PG  L     P+FPR
Sbjct: 485 SRLLDLLGVPAEGDAGRTGASGSGPRSFAAFHEDLVPGTPLPAP-QPVFPR 534


>gi|326403063|ref|YP_004283144.1| methionyl-tRNA synthetase [Acidiphilium multivorum AIU301]
 gi|325049924|dbj|BAJ80262.1| methionyl-tRNA synthetase [Acidiphilium multivorum AIU301]
          Length = 511

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 327/506 (64%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N  PHIGHAY  + ADVLARF RLDG DV F TGTDEHGQK+   A+  
Sbjct: 4   KFYITTPIYYVNGAPHIGHAYTSVAADVLARFKRLDGFDVHFLTGTDEHGQKVEATARAN 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
            +  + F D+ +  FR MA  ++IS DDFIRTTE RH  +C+ +W+ I   G I  G Y 
Sbjct: 64  NIAPQEFTDRIAGEFRAMAQAMNISNDDFIRTTEPRHIRSCQAIWQAIERAGAIELGHYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY++RDEA+Y++ E+  GADG   +    PV+W+ E  YFF+LS +QD+LL  YE +PE
Sbjct: 124 GWYAVRDEAFYDESELVTGADGIKRSPFGAPVEWVREPSYFFKLSTFQDRLLKLYEDNPE 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P   RNEV+SFV+SGL+D+S+SR +F WGI +P  P ++MYVWIDALTNYLT  GY 
Sbjct: 184 FIQPASSRNEVLSFVRSGLRDISISRTSFKWGIPVPGAPDHVMYVWIDALTNYLTACGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  D    K+WPADLH++GK+I RFHA+YWPA L++A LP+P+++F++G+   +GEK+SK
Sbjct: 244 DM-DAPLMKYWPADLHLVGKEITRFHAVYWPAMLMAAGLPVPRRIFANGWWTIEGEKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SL N +    +I E G+D LR+ L+RE+  G DG + +  +  R+N +LAN +GNL  R+
Sbjct: 303 SLNNALAVEPLIAEFGLDQLRFCLLREMPFGNDGNFSRRSVITRINVELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I K+  G++P  G   E+D ++ ++   +   +R+ M       A+ +V  LV   +
Sbjct: 363 LSFIAKNAGGVVPEAGPAAEADHALRAIADGLPDRMRDAMDRLAYQEAIEEVWKLVRAAN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW L+KT+P R  TVL    E +R + ILLQ F+P+   K+ D L +  + R 
Sbjct: 423 AYIDHQAPWALRKTDPQRMLTVLRTLCEALRVVGILLQPFMPEAMAKLLDQLALPADRRG 482

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F SL   L  G +L      +FPR +
Sbjct: 483 FASLATPLDAGAVLPPP-SGLFPRIV 507


>gi|148259982|ref|YP_001234109.1| methionyl-tRNA synthetase [Acidiphilium cryptum JF-5]
 gi|146401663|gb|ABQ30190.1| methionyl-tRNA synthetase [Acidiphilium cryptum JF-5]
          Length = 511

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 327/506 (64%), Gaps = 2/506 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N  PHIGHAY  + ADVLARF RLDG DV F TGTDEHGQK+   A+  
Sbjct: 4   KFYITTPIYYVNGAPHIGHAYTSVAADVLARFKRLDGFDVHFLTGTDEHGQKVEATARAN 63

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
            +  + F D+ +  FR MA  ++IS DDFIRTTE RH  +C+ +W+ I   G I  G Y 
Sbjct: 64  NIAPQEFTDRIAGEFRAMAQAMNISNDDFIRTTEPRHIRSCQAIWQAIERAGAIELGHYE 123

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY++RDEA+Y++ E+  GADG   +    PV+W+ E  YFF+LS +QD+LL  YE +PE
Sbjct: 124 GWYAVRDEAFYDESELVTGADGIKRSPFGAPVEWVREPSYFFKLSMFQDRLLKLYEDNPE 183

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P   RNEV+SFV+SGL+D+S+SR +F WGI +P  P ++MYVWIDALTNYLT  GY 
Sbjct: 184 FIQPASSRNEVLSFVRSGLRDISISRTSFKWGIPVPGAPDHVMYVWIDALTNYLTACGYP 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D  D    K+WPADLH++GK+I RFHA+YWPA L++A LP+P+++F++G+   +GEK+SK
Sbjct: 244 DM-DAPLMKYWPADLHLVGKEITRFHAVYWPAMLMAAGLPVPRRIFANGWWTIEGEKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SL N +    +I E G+D LR+ L+RE+  G DG + +  +  R+N +LAN +GNL  R+
Sbjct: 303 SLNNALAVEPLIAEFGLDQLRFCLLREMPFGNDGNFSRRSVITRINVELANDLGNLAQRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           +S I K+  G++P  G   E+D ++ ++   +   +R+ M       A+ +V  LV   +
Sbjct: 363 LSFIAKNAGGVVPEAGPAAEADHALRAIADGLPDRMRDAMDRLAYQEAIEEVWKLVRAAN 422

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
            Y D Q PW L+KT+P R  TVL    E +R + ILLQ F+P+   K+ D L +  + R 
Sbjct: 423 AYIDHQAPWALRKTDPQRMLTVLRTLCEALRVVGILLQPFMPEAMAKLLDQLALPADRRG 482

Query: 486 FQSLDQRLKPGFMLHKTFDPIFPRFL 511
           F SL   L  G +L      +FPR +
Sbjct: 483 FASLATPLDAGAVLPPP-SGLFPRIV 507


>gi|149184557|ref|ZP_01862875.1| methionyl-tRNA synthetase [Erythrobacter sp. SD-21]
 gi|148831877|gb|EDL50310.1| methionyl-tRNA synthetase [Erythrobacter sp. SD-21]
          Length = 519

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 246/515 (47%), Positives = 333/515 (64%), Gaps = 21/515 (4%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+TAI YPN +PHIGHAYE + ADV+ARF RL G DV F TGTDEHG K+A+ A++ G 
Sbjct: 6   YITTAIHYPNGKPHIGHAYETVAADVIARFQRLMGRDVRFQTGTDEHGLKMAQKARDLGK 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T +   D+ S  F+D+ D LDI+YD FIRTT++ HH   R +W+ +  K D+Y   Y GW
Sbjct: 66  TPRELADEMSGAFKDLFDRLDITYDRFIRTTDEDHHKASRAIWEAMEAKSDLYLDRYEGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+RDEAYY++ E+ +G  G+  + Q  PV+W EEE +FFRLS Y + LL    + P F+
Sbjct: 126 YSVRDEAYYDEKELVEGEGGEMLSPQGTPVEWTEEETWFFRLSKYAEPLLELLNT-PGFL 184

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  RRNE+I+FV+ GLKDLS+SR +FDWG+K+P    ++MYVW+DALTNY+T  GY   
Sbjct: 185 EPASRRNEMIAFVEGGLKDLSVSRTSFDWGVKVPGADNHVMYVWVDALTNYITGVGY--- 241

Query: 248 PDGSKA--KFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           PDG +   K+WPA LH+IGKDI+RFH +YWPAFL+SAN+PLPK+VF HGF+L++G K SK
Sbjct: 242 PDGGEMWDKYWPASLHLIGKDIVRFHTVYWPAFLMSANIPLPKQVFGHGFLLNRGVKESK 301

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV DPIE+I+  GVD+LRYFL+ E+  GKDG Y  + L  +VNA+LAN  GNL  R+
Sbjct: 302 SAGNVTDPIELIDLFGVDSLRYFLMAEVVFGKDGSYSAEALVNKVNAELANSFGNLAQRT 361

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQL----IHRALAQVISLV 421
           +SMI K+ DG + T     E++    ++ + V +  RE +  +         +   +  V
Sbjct: 362 LSMIHKNMDGKLET----FETNGDDKTLLATVQEACRETLPREFEALNFSVGIEAWLKAV 417

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
              + Y D Q PW LKK++P+R   VL   +  IR LAI +Q  VP  A  + D L V  
Sbjct: 418 FACNAYVDEQAPWGLKKSDPERMKAVLQTLLLAIRDLAIAIQPVVPTKAAAVLDQLGVTP 477

Query: 482 ENRCFQSLDQR------LKPGFMLHKTFDPIFPRF 510
           + R +  L         +  G ++ K   P FPR 
Sbjct: 478 DRRSYADLSDEGWFGSLVAAGHVVEKP-TPAFPRL 511


>gi|103486745|ref|YP_616306.1| methionyl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
 gi|98976822|gb|ABF52973.1| methionyl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
          Length = 527

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/516 (45%), Positives = 335/516 (64%), Gaps = 9/516 (1%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           ++    YI+TAI+YPN +PHIGHAYE I  DV+ARF R  G +V   TGTDEHG K+ + 
Sbjct: 3   QQSAPFYITTAISYPNGRPHIGHAYEAIATDVMARFQRARGRNVRLVTGTDEHGLKMFQT 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A++ G  T    ++ S  FR+M   L+ISYD F+RT++  HH   + +WK +   GD+Y 
Sbjct: 63  ARDQGRATIDLANEMSGYFREMYAKLNISYDMFMRTSDPAHHAASQAIWKAMEANGDLYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
             Y GWYS+RDEA+Y++ E+  G +G   + Q  PV+W  EE +FFRLS YQD+LL+ Y 
Sbjct: 123 DRYEGWYSVRDEAFYDESELTDGGEGIRLSPQGTPVEWTVEESWFFRLSNYQDRLLALYR 182

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
            +P+FI P  RRNEV+ FV+ GLKDLS+SR +FDWG+ +P  P ++MYVW+DALT YL+ 
Sbjct: 183 DNPDFIRPESRRNEVLRFVEGGLKDLSVSRTSFDWGVPVPGSPGHVMYVWVDALTTYLSG 242

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY D P      FWPA++H+IGKDI+RFH +YWPAFL+SANLPLP++VF HGF+L++GE
Sbjct: 243 LGYPD-PASDFGTFWPANIHMIGKDIVRFHTVYWPAFLMSANLPLPRQVFGHGFLLNRGE 301

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKSLGNV+DP+ + E  GVDALRY+L+RE++ G+DG Y  + + +  NADLAN  GNL
Sbjct: 302 KMSKSLGNVVDPMALAERFGVDALRYYLLREVSFGQDGSYSAEAIVRTANADLANSFGNL 361

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHR-ALAQVISL 420
             RS+SMI K+  G +       + D  +  + +   +++      QL     + + +  
Sbjct: 362 AQRSLSMIFKNLGGELSADYTPAQDDIDLFHLVNLSAKDLLPRAFEQLAFSVGIEEWLRA 421

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           V   ++Y DAQ PW L+K++P+R   VL    + +R LAI ++  VP  A+ + D + +A
Sbjct: 422 VFACNQYVDAQAPWALRKSDPERMRVVLMTLFQAVRTLAIAIRPVVPTAADNLLDQMGIA 481

Query: 481 DENRCFQSLD-----QRLKP-GFMLHKTFDPIFPRF 510
            + R F +L       RL   GF + +   PIFPR 
Sbjct: 482 PDARDFAALADADWFARLAASGFTVGQPV-PIFPRL 516


>gi|51473863|ref|YP_067620.1| methionyl-tRNA synthetase [Rickettsia typhi str. Wilmington]
 gi|81826289|sp|Q68W54|SYM_RICTY RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|51460175|gb|AAU04138.1| MetRS [Rickettsia typhi str. Wilmington]
          Length = 507

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 246/513 (47%), Positives = 338/513 (65%), Gaps = 15/513 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I Y N   HIGHAY  + +DV+ARF R  G DV+F TGTDEHGQK+ KAA 
Sbjct: 2   KNTYYITTPIYYVNDVSHIGHAYTSVASDVIARFMRCCGKDVMFLTGTDEHGQKVEKAAI 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           N  +  + F D+ S+NFRD+   ++IS DDFIRTTE RH     + W+K+ D G IY+G 
Sbjct: 62  NKNIDPQSFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWQKLLDNGAIYEGF 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWYS+RDEA+Y++ E+ +            PV+W++E  YFF L+ +QDKLL +YE +
Sbjct: 122 YEGWYSVRDEAFYDESEITEDKLA----PTGAPVEWVKEPSYFFNLAKWQDKLLEFYELN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+ PI RRNEVISFVKSGLKDLS+SR TF+WGIK+P++ ++++YVW+DAL NY++  G
Sbjct: 178 PDFVRPISRRNEVISFVKSGLKDLSISRTTFNWGIKVPNNEKHVIYVWLDALVNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y D    + +KFWPA+L V+GKDILRFHA+YWPAFL++A +  PK +  HG+  + G+KI
Sbjct: 238 YPDQ-QSNYSKFWPANLQVVGKDILRFHAVYWPAFLMAAEISPPKSIMVHGWWTNAGQKI 296

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDPI +I+E GVD +RYFL+RE+  G D  + ++ L  R+N++L+N IGNL+ 
Sbjct: 297 SKSLGNTIDPITLIDEFGVDQVRYFLMREVIFGADANFTRNNLITRINSELSNKIGNLLH 356

Query: 364 RSVSMILKDYDGMIP--TPGAFTESDE-SILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           R VS +  + D  +P    G   +  E  IL    +  QE    M    I++ L  +I+L
Sbjct: 357 RIVSFVYNNNDAKVPLIKSGVIDKIYELPILKTAMKFAQENILLMDKIEINKILENIINL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
             + + Y   + PW LKKT+ D+   VLY  +EV+R +AI+LQ FVP  ANK+ D L VA
Sbjct: 417 AEDANIYIANEAPWNLKKTDYDKMLEVLYTLLEVLRYVAIMLQPFVPSSANKMLDQLGVA 476

Query: 481 DENRCFQSL--DQRLKPGFMLHKTFDP--IFPR 509
            E R F+ L  D  LK G       +P  IFP+
Sbjct: 477 KEERLFKHLVRDHALKAG---SNILEPSIIFPK 506


>gi|219123327|ref|XP_002181978.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217406579|gb|EEC46518.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 574

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/506 (46%), Positives = 338/506 (66%), Gaps = 11/506 (2%)

Query: 9   ISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVT 68
           I+T I Y N +PHIGHAY     DV+ARF RL G DV F +GTDEHG+K+ ++A+   + 
Sbjct: 64  ITTPIYYVNDKPHIGHAYTSTACDVIARFMRLSGRDVFFLSGTDEHGEKVEQSAEKQNMD 123

Query: 69  TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWY 128
            + FVDQ S NFR++ ++++IS D FIRTT + H  + +  W  + +KG IY G YSGWY
Sbjct: 124 PQGFVDQVSVNFRELLELMNISNDKFIRTTSEDHKKSVQHFWNVMVEKGYIYMGTYSGWY 183

Query: 129 SLRDEAYYNDDEVYKGADGQYYNAQHNPVQWM-EEEGYFFRLSAYQDKLLSYYESHPEFI 187
           S+RDE +Y + E+    DG+        V W+ +EE YFF+LS +++KLL  YE +P FI
Sbjct: 184 SVRDECFYTESELI---DGKAPTGAE--VSWVAKEESYFFKLSQFEEKLLDLYERNPHFI 238

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  R+NEV+SFVK GL+DLS+SR +F WG+ +PDD  ++MYVW+DALTNY++  GY D 
Sbjct: 239 APESRKNEVVSFVKGGLRDLSISRTSFKWGVPVPDDEDHVMYVWVDALTNYISALGYPDM 298

Query: 248 PDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
            +GS  +KFWPA +H++GKDILRFHA+YWPA L++A LPLPK++F+HG+    G+KISKS
Sbjct: 299 GEGSDFSKFWPASIHIVGKDILRFHAVYWPAMLMAAELPLPKRLFAHGWWTKDGQKISKS 358

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           +GNVIDP+E++ + GVD  R+FL+ E+  G DG +    + ++ N +LAN +GNL  R++
Sbjct: 359 IGNVIDPVELVNKYGVDQTRFFLMSEVNFGNDGDFSDRAMIQKCNTNLANELGNLCQRTL 418

Query: 367 SMILKDYDGMIPTP-GAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           S++ K+ +  +P P GA+T  DE++L     +  ++   +  Q I + +  ++ ++ E +
Sbjct: 419 SLVFKNCEKAVPNPVGAYTPEDEALLESARNLRNKVATEISQQSILKYVHAMVEMIWEAN 478

Query: 426 RYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRC 485
           +Y D   PW LKKT+P+R +TVLYV +EV+R  AIL Q  +P+ A KI D L V    R 
Sbjct: 479 KYIDEMAPWALKKTDPERMATVLYVLLEVLRYSAILYQPLIPESAGKILDQLTVPANERT 538

Query: 486 FQSLDQR--LKPGFMLHKTFDPIFPR 509
           F  L +   +K G  + K    IFPR
Sbjct: 539 FLHLSEEYSIKAGAAISKPVG-IFPR 563


>gi|20806639|ref|NP_621810.1| methionyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4]
 gi|25009362|sp|Q8RDD1|SYM_THETN RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|20515086|gb|AAM23414.1| Methionyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4]
          Length = 638

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/508 (46%), Positives = 339/508 (66%), Gaps = 6/508 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV+F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRIAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+   +DISYD FIRTT+  H +  + ++ K+ ++GDIYKG 
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKTMDISYDHFIRTTDAYHEEIVQKIFMKLYEQGDIYKGE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +    PV+ + EEGYFFRLSAY DKLL YYE H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGR-PVERVTEEGYFFRLSAYGDKLLKYYEEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+K+GL+DL +SR TFDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKAGLEDLFVSRSTFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPKKVF HG+++ +G K+
Sbjct: 238 YMTENDEKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E+++  GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVDRYGVDAIRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K +DG++P P +  E DE +++V   + Q++ E M       AL ++  LVS 
Sbjct: 358 RTVTMIEKYFDGVLPKPSSQEEIDEDLINVAQNLPQKVEEYMDKLQFSNALIEIWKLVSR 417

Query: 424 VDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K    R    TVLY   E +R + IL+  F+P    K+F+ L + +
Sbjct: 418 ANKYIDETMPWVLAKDESKRGRLGTVLYNLAESLRFIGILISPFMPNTPKKMFEQLGITE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
           +   ++SL   L       K  + +FPR
Sbjct: 478 DLTTWESLKFGLLKEGTRVKRGEILFPR 505


>gi|71083692|ref|YP_266412.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062805|gb|AAZ21808.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 513

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/470 (47%), Positives = 326/470 (69%), Gaps = 1/470 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I YP+A+PH+GHAY  I+AD  ARF R+DG +V F TGTDEHG KI +AA+   +
Sbjct: 6   YITTPIYYPSARPHMGHAYSSIVADFFARFKRIDGFNVHFLTGTDEHGLKIQRAAERKKI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F D+ S+ FRD++  L++S  DFIRTTE+RH  T + LW ++    DIY   YSGW
Sbjct: 66  DPQTFCDEISQTFRDLSKTLNLSNTDFIRTTEERHKKTVQHLWNELEKNDDIYLSKYSGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+ DEAYY+D+E+ +  + +   +  + V+W+EEE YFFRLS +QD+LL YYE +P+FI
Sbjct: 126 YSVSDEAYYSDEEISEKENVKIAISSGSSVEWIEEESYFFRLSKWQDELLKYYEKNPDFI 185

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  R+NEVISFVK GLKDLS+SRK F WGIK+P+   +++YVW+DALTNYL+   Y D 
Sbjct: 186 SPKSRKNEVISFVKGGLKDLSISRKAFSWGIKVPNSQDHVIYVWLDALTNYLSALNYPDT 245

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
            D    KFWPA +H+IGKDILRFH++YWPAFL++A +PLPKKV+ HG+IL   EK+SKS 
Sbjct: 246 NDELFKKFWPASVHLIGKDILRFHSVYWPAFLMAAKIPLPKKVYGHGWILSGDEKMSKSK 305

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN++DP+++IE  G+D LRY+L++E++ G DG   +D L+  +N+DLAN  GNL  R  +
Sbjct: 306 GNILDPLDIIEIYGLDPLRYYLIKEVSFGNDGNISQDRLEDCINSDLANNYGNLCQRVTA 365

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRY 427
              K+   ++P    F + D  +L+  +  L  IR  + NQ I+  +  ++S + E ++Y
Sbjct: 366 FAEKNCSSLVPDNTKFNDEDLVMLNKFTDNLDLIRTEIDNQNINYYINFIVSALFEANKY 425

Query: 428 FDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           F+ Q+PW+ KK + DR +T++Y ++E+IR+++ +L   +P    K   I 
Sbjct: 426 FNDQEPWK-KKDDKDRLNTIVYTSLEMIRKISFMLYPIIPSSIEKALKIF 474


>gi|85374072|ref|YP_458134.1| methionyl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
 gi|84787155|gb|ABC63337.1| methionyl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
          Length = 519

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/512 (46%), Positives = 327/512 (63%), Gaps = 9/512 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  YI+TAI+YPN +PHIGHAYE I ADV+ARF R  GLDV F TGTDEHG K+A+ A+ 
Sbjct: 3   EPFYITTAISYPNGRPHIGHAYEAIAADVIARFQRQRGLDVRFQTGTDEHGLKMARKAEE 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G + +   D+ S  F+ M D L++S D FIRT +  HH   + +W+ +   GD+Y   Y
Sbjct: 63  QGKSPRDLADEMSGYFKAMCDALNVSCDRFIRTVDDDHHRASQAIWRAMEAAGDLYLDRY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWYS+RDEAYY++ E+  G   +  + Q  PV+W  EE +FFRLS Y+DKLL   ES P
Sbjct: 123 EGWYSVRDEAYYDESELVDGEGDEKLSPQGTPVEWTVEESWFFRLSKYEDKLLKLLES-P 181

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
            F+ P  RRNE+++FVK GL+DLS+SR +FDWG+K+P    ++MYVW+DALTNY+T  GY
Sbjct: 182 GFLEPASRRNEMVAFVKQGLRDLSVSRTSFDWGVKVPGSEDHVMYVWVDALTNYITGLGY 241

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D+ +  + K WPADLH+IGKDI+RFH IYWPAFL+SA LP+PK+VF HGF+L  G K S
Sbjct: 242 PDDTELWR-KHWPADLHLIGKDIVRFHTIYWPAFLMSAGLPVPKQVFGHGFVLKDGRKES 300

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGNV DP ++ +  GVDALRYFL+RE++ G DG +  + +  RVNA+LAN  GNL  R
Sbjct: 301 KSLGNVTDPHDLADFYGVDALRYFLMREVSFGSDGNWSHEAIVTRVNAELANSFGNLAQR 360

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++SMI K+ DG +    A  E    + +V +   + +    +       + + I  V   
Sbjct: 361 TLSMIHKNMDGSLEKFEARGEDKALLQTVLTACRESLPREFEKLAFSVGIDEWIKAVYAC 420

Query: 425 DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           ++Y D Q PW L+KT+P+R   VL   +  I  LAI +Q  +P+ A  + D L V  + R
Sbjct: 421 NQYVDEQAPWALRKTDPERMKAVLQTLLMAIHDLAIAIQPVIPEKAGALLDDLGVPTDRR 480

Query: 485 CFQSL------DQRLKPGFMLHKTFDPIFPRF 510
            +  +      +Q +  GF + K   P FPR 
Sbjct: 481 TYDHISGEGWFNQLVAEGFTVPKP-TPAFPRL 511


>gi|68171729|ref|ZP_00545082.1| Methionyl-tRNA synthetase, class Ia [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88657921|ref|YP_507787.1| methionyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
 gi|67998851|gb|EAM85550.1| Methionyl-tRNA synthetase, class Ia [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599378|gb|ABD44847.1| methionyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
          Length = 506

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/509 (46%), Positives = 336/509 (66%), Gaps = 10/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
           +YI+T I Y N  PHIGH Y  +I+D++ARF RLDG  V F TGTDEHGQKI KAAQ   
Sbjct: 4   IYITTPIYYVNDVPHIGHVYTTLISDIIARFMRLDGHSVKFITGTDEHGQKIEKAAQERN 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++   F D  S  FR +ADV++ SYDDFIRTTE RH  T   LW+++ D G IY G YSG
Sbjct: 64  MSLLDFTDNTSAVFRQLADVMNYSYDDFIRTTETRHKKTVVALWQRLCDNGAIYLGSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDE +Y + E+    DG+        V+W+EE  YFFRLS +Q++LL++YE +P+F
Sbjct: 124 WYSVRDETFYQEKEL---VDGKAPTGAD--VEWIEEPSYFFRLSNFQERLLAFYEENPDF 178

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           ++P  R NEVISFVKSGLKDLS+SR+   WGIK+P+D ++++YVW+DAL NYLT  G+ D
Sbjct: 179 VIPKYRYNEVISFVKSGLKDLSVSRQNVLWGIKVPNDDKHVIYVWVDALANYLTVLGFPD 238

Query: 247 NPDGSKAKFWPAD----LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
                   +W +D    L V+GKDILRFHA+YWPA L++A LPLPKK+ +HG+  ++G+K
Sbjct: 239 ENHKDYQAYWASDSSSVLQVVGKDILRFHAVYWPAILMAAELPLPKKILAHGWWTNEGQK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKSLGNVI P +++EE GVD LRYFL++E+  G DG + ++ L   +N DLAN IGNLV
Sbjct: 299 ISKSLGNVIKPFDLVEEFGVDQLRYFLIKEMPIGNDGDFKRNSLINCINYDLANNIGNLV 358

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R+VS++ K+  G++PT        E +L     +L+++R+ +    ++  +  +  L S
Sbjct: 359 QRTVSLLYKECGGIVPTVSGNLLQGEEVLPDYQEILEKVRDCVMRCNLNEMIHIIEQLSS 418

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
             + Y  ++ PW L K++P     VLY  +E I+ + +LLQ  +PKL++KI D + + + 
Sbjct: 419 AANEYIASRAPWRLSKSDPKIMEAVLYKLLEYIKCIGLLLQPVMPKLSSKILDQIGLPEC 478

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           NR F      +    +L K  +PIF + L
Sbjct: 479 NRDFSRFSIPINMNTVLPKP-EPIFAKIL 506


>gi|91763268|ref|ZP_01265232.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717681|gb|EAS84332.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 513

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/472 (47%), Positives = 331/472 (70%), Gaps = 4/472 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I YP+A+PH+GHAY  I+AD  ARF R+DG +V F TGTDEHG KI +AA+   +
Sbjct: 6   YITTPIYYPSARPHMGHAYSSIVADFFARFKRIDGFNVHFLTGTDEHGLKIQRAAERKKI 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
             + F D+ S+ FRD++  L++S  DFIRTTE+RH  T + LW ++    DIY   YSGW
Sbjct: 66  DPQTFCDEISQTFRDLSKTLNLSNTDFIRTTEERHKKTVQHLWNELEKNDDIYLSKYSGW 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           YS+ DEAYY+D+E+ +  + +   +  + V+W+EEE YFFRLS +QD+LL YYE +P+FI
Sbjct: 126 YSVSDEAYYSDEEIIEKENVKIAISSGSSVEWIEEESYFFRLSKWQDELLKYYEKNPDFI 185

Query: 188 LPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDN 247
            P  R+NEVISFVK GLKDLS+SRK F WGIK+P+   +++YVW+DALTNY++   Y D 
Sbjct: 186 SPKSRKNEVISFVKGGLKDLSISRKAFSWGIKVPNSQDHVIYVWLDALTNYISALNYPDT 245

Query: 248 PDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSL 307
            D    KFWPA +H+IGKDILRFH++YWPAFL++A +PLPKKV+ HG+IL   EK+SKS 
Sbjct: 246 NDELFKKFWPASVHLIGKDILRFHSVYWPAFLMAAKIPLPKKVYGHGWILSGDEKMSKSK 305

Query: 308 GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVS 367
           GN++DP+++IE  G+D LRY+L++E++ G DG   +D L+  +N+DLAN  GNL  R  +
Sbjct: 306 GNILDPLDIIEIYGLDPLRYYLIKEVSFGNDGNISQDRLEDCINSDLANNYGNLCQRVTA 365

Query: 368 MILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRY 427
              K+   ++P    F + D  +L+  +  L  IR  + NQ I+  +  ++S + E ++Y
Sbjct: 366 FAEKNCSSLVPDNIKFNDEDLVMLNKFTDNLDIIRTEIDNQNINYYINFIVSSLFEANKY 425

Query: 428 FDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVP---KLANKIFDI 476
           F+ Q+PW+ KK + +R +T++Y ++E+IR+++ +L   +P   + A KIFD+
Sbjct: 426 FNDQEPWK-KKDDKNRLNTIVYTSLEMIRKISFMLYPIIPSSIEKALKIFDL 476


>gi|299471948|emb|CBN79628.1| Methionyl-tRNA synthetase [Ectocarpus siliculosus]
          Length = 613

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 241/539 (44%), Positives = 341/539 (63%), Gaps = 37/539 (6%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE    Y++T I Y N +PHIGHAY  +  DV+ARF RLDG +V+F TGTDEHGQK+  +
Sbjct: 71  KEMPPYYVTTPIYYVNDKPHIGHAYTTLACDVIARFMRLDGREVMFLTGTDEHGQKVEAS 130

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  A  + + F D+ S+ FRD+   ++ S D FIRTT+  H      LW ++ ++G I  
Sbjct: 131 ALKADKSPQQFCDEVSQEFRDLLKTMNFSNDRFIRTTDTSHKVAASALWNRLQERGQISL 190

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEE-GYFFRLSAYQDKLLSYY 180
           G Y+GWYS+RDEA+Y + E+    DG+  +     V+W+E+E  YFF+LS +Q  LL +Y
Sbjct: 191 GVYAGWYSVRDEAFYGEAEL---VDGKAPSGAE--VEWVEKEPSYFFKLSEWQQPLLDFY 245

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
             +P+FI P  RRNE +SFV  GL+DLS+SR +F WG+ +P D +++MYVW+DAL NY++
Sbjct: 246 AENPQFIAPESRRNEAVSFVSGGLRDLSISRTSFSWGVPVPGDDEHVMYVWVDALANYIS 305

Query: 241 TTGYLDNPD-GSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
             G+ +  + G  +KFWPADLHVIGKDILRFH++YWPA LL+A L  PK++F HG+    
Sbjct: 306 ALGFPEMGEAGEFSKFWPADLHVIGKDILRFHSVYWPALLLAAGLEPPKRLFVHGWWTKD 365

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           G+KISKS GNVIDP++++   GVDA RYFL+ E+  G DG + +   + RVN++LAN +G
Sbjct: 366 GQKISKSTGNVIDPLDLVARYGVDATRYFLMSEVPFGNDGDFSETAFQNRVNSNLANEVG 425

Query: 360 NLVSRSVSMILKDYDGMIPTPGA---------------------FTESDESILSVCSRVL 398
           NL  R++SM +K+  G +P P A                      T  D+ +L      L
Sbjct: 426 NLAMRTLSMAVKNCGGQVPRPAAAADAGDVDEGGDKALGREDFDLTPEDKELLKSAGECL 485

Query: 399 QEIRENM-QNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQ 457
             +R  + + Q +H+AL  ++ +  + +RY D Q PW+LKKT+PDR  TVL+V +E IR 
Sbjct: 486 GVVRPLVGETQQLHKALEAILLVSRDANRYVDFQAPWKLKKTDPDRMKTVLWVLLETIRH 545

Query: 458 LAILLQAFVPKLANKIFDILFVAD-ENRCFQSLDQ------RLKPGFMLHKTFDPIFPR 509
           + IL Q FVP+ A K+ D L V + + R F +LDQ       L+PG  L K   P+FPR
Sbjct: 546 VGILYQPFVPEAAGKLLDQLGVPEGDARLFAALDQGGGGRFSLQPGVPLDKPV-PVFPR 603


>gi|189183674|ref|YP_001937459.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
 gi|189180445|dbj|BAG40225.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
          Length = 511

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/512 (45%), Positives = 340/512 (66%), Gaps = 11/512 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           + K YI+T I Y N  PHIGHAY  I+ADV ARF RL G +V+F TGTDEHGQK+ KAA 
Sbjct: 2   KSKYYITTPIYYVNDIPHIGHAYTSILADVYARFMRLLGKEVIFLTGTDEHGQKVEKAAS 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           NAGV+ K FVD+ + +F  ++  L++S DDFIRTT+ +H    + LWK +  +GDIY G 
Sbjct: 62  NAGVSPKEFVDKIASSFVKLSVDLNLSNDDFIRTTDTKHIKAVQKLWKVLEQQGDIYLGK 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY+++DEA+Y++ E+    DG+        V+W+EE  YFF LS +Q KLL +YE++
Sbjct: 122 YCGWYAIKDEAFYSESEL--TTDGKAPTGAE--VEWVEESSYFFALSKWQQKLLDWYENN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
            + I P   RNEVI+F+K+GL DLS+SR TF WGI +P+D  +++YVW+DAL NY++  G
Sbjct: 178 HDIIKPAFFRNEVINFIKNGLIDLSISRTTFKWGIAVPNDSSHVIYVWLDALVNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  +       FWPADLH++GKDILRFHA+YWPAFL+SA LPLPK +  HG+  ++G+KI
Sbjct: 238 YASDNGTLMTNFWPADLHIVGKDILRFHAVYWPAFLMSAGLPLPKAILVHGWWTNEGQKI 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVI+P+E+  + G+D +RYFL+REI  G DG ++K     R+N++L N +GNLV 
Sbjct: 298 SKSVGNVINPVELTSKFGIDQVRYFLLREITIGNDGNFNKISFINRINSELCNKLGNLVH 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESD----ESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           R++S I K     IP     T ++    ES+L     +   +   + N+ +   L +++ 
Sbjct: 358 RTLSFIYKYNKAKIPQLDGITITNLYKSESLLLKIVMLSDNLANIIDNENVTVILNRIME 417

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +V++ + YFD Q PW+ K +N  + +T+LY  +E IR +AILLQ F+P+ AN I D++ +
Sbjct: 418 IVNQANIYFDQQAPWKFKDSNSQKIATILYTLIETIRCIAILLQPFIPESANTILDLIAI 477

Query: 480 ADENRCFQSLDQR--LKPGFMLHKTFDPIFPR 509
               R F  +++   +KPG  + +   PIF +
Sbjct: 478 DKTERMFSCINRSHAIKPGKTILEP-KPIFVK 508


>gi|148285047|ref|YP_001249137.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
 gi|146740486|emb|CAM81042.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
          Length = 511

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/512 (45%), Positives = 337/512 (65%), Gaps = 11/512 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           + K YI+T I Y N  PHIGHAY  I+ADV ARF RL G +V+F TGTDEHGQK+ KAA 
Sbjct: 2   KSKYYITTPIYYVNDIPHIGHAYTSILADVYARFMRLLGKEVIFLTGTDEHGQKVEKAAS 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           NAGV+ K FVD+ + +F  ++  L++S DDFIRTT+ RH    + LW  +  +GDIY G 
Sbjct: 62  NAGVSPKEFVDKIASSFVKLSVDLNLSNDDFIRTTDTRHIKAVQKLWNILKQQGDIYLGK 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY+++DEA+Y++ E+    DG+        V+W+EE  YFF LS +Q KLL +YE++
Sbjct: 122 YCGWYAIKDEAFYSESEL--TTDGKAPTGAE--VEWVEESSYFFALSKWQQKLLDWYENN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
            + I P   RNEVI+F+K+GL DLS+SR TF WGI +P+D  +++YVW+DAL NY++  G
Sbjct: 178 HDIIKPAFFRNEVINFIKNGLIDLSISRTTFKWGIAVPNDSSHVIYVWLDALVNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  +       FWPADLH++GKDILRFHA+YWPAFL+SA LPLPK +  HG+  ++G+KI
Sbjct: 238 YASDNGTLMTNFWPADLHIVGKDILRFHAVYWPAFLMSAGLPLPKAILVHGWWTNEGQKI 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS+GNVI+P+E+  + G+D +RYFL+REI  G DG + K     R+N++L N +GNLV 
Sbjct: 298 SKSVGNVINPVELTSKFGIDQVRYFLLREITIGNDGNFSKISFINRINSELCNKLGNLVH 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESD----ESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           R++S I K     IP     T ++    ES+L     +   +   + N+ +   L +++ 
Sbjct: 358 RTLSFIYKYNKAKIPQLDGITITNLYKSESLLLKIVMLSDNLANIIDNENVTVILNRIME 417

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +V++ + YFD Q PW+ K +N  + +T+LY  +E IR +AILLQ F+P+ AN I D++ +
Sbjct: 418 IVNQANIYFDQQTPWKFKDSNSQKIATILYTLIETIRCIAILLQPFIPESANTILDLIAI 477

Query: 480 ADENRCFQSLDQR--LKPGFMLHKTFDPIFPR 509
               R F  ++    +KPG  + +   PIF +
Sbjct: 478 EKTERTFSCINSSYAIKPGKTILEP-KPIFVK 508


>gi|256751388|ref|ZP_05492267.1| methionyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749770|gb|EEU62795.1| methionyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 632

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 338/508 (66%), Gaps = 6/508 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+  ++DISYD FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +    PV+ ++EEGYFFRLS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGR-PVERVKEEGYFFRLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTDHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNETLINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K +DG++P P    E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFDGILPKPSQKEEVDDDLINTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +A+L+  F+P    KIF+ L V +
Sbjct: 418 ANKYIDETMPWVLAKDESKKERLGTVLYNLTEALRFIAVLISPFMPNTPKKIFEQLGVEE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
               ++SL   L       K  + IFPR
Sbjct: 478 NLTTWESLKFGLLKEGTKVKRGEIIFPR 505


>gi|73667420|ref|YP_303436.1| methionyl-tRNA synthetase [Ehrlichia canis str. Jake]
 gi|72394561|gb|AAZ68838.1| methionyl-tRNA synthetase [Ehrlichia canis str. Jake]
          Length = 506

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/513 (46%), Positives = 338/513 (65%), Gaps = 18/513 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
           +YI+T I Y N  PHIGH Y  +I+D++ARF RLDG +V F TGTDEHGQK+ KAAQ   
Sbjct: 4   IYITTPIYYVNDVPHIGHVYTTLISDIIARFMRLDGYNVKFVTGTDEHGQKVEKAAQERN 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++   F +  S  FR +ADV++ SY+DF+RTTE RH      LW  + D   +Y G YSG
Sbjct: 64  ISLLEFTNGTSAVFRQLADVMNYSYNDFVRTTEMRHKKAVTALWTSLCDNDMVYLGSYSG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+RDEA+Y + E+    DG+        V+W+EE  YFFRLS +Q+KLL++YE HP+F
Sbjct: 124 WYSVRDEAFYQEKEL---IDGKAPTGAE--VEWIEEPSYFFRLSDFQEKLLTFYEEHPDF 178

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I+P  R NEVISFVKSGLKDLS+SRK   WGIK+P+D ++++YVW+DAL NYLT  G+ D
Sbjct: 179 IIPKYRYNEVISFVKSGLKDLSVSRKNVVWGIKVPNDDEHVIYVWVDALANYLTVLGFPD 238

Query: 247 NPDGSKAKFWPAD----LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
                   +W  D    LHV+GKDILRFHA+YWPA L++A LPLPKK+ +HG+  ++G+K
Sbjct: 239 VKSKDYQTYWGNDNSTVLHVVGKDILRFHAVYWPAILMAAGLPLPKKILAHGWWTNEGQK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKSLGN+I P +++EE GVD LRYFL++E+  G DG + +    K +N+DLAN IGNLV
Sbjct: 299 ISKSLGNIIKPFDLVEEFGVDQLRYFLIKEMPIGNDGDFKRSSFIKCINSDLANNIGNLV 358

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQ----NQLIHRALAQVI 418
            R+VS++ K+ +G +P        +E +L     +L++ R  ++    N LIH  + Q+ 
Sbjct: 359 QRTVSLLYKECEGKVPLVNNSLLRNEEVLPDYQEILEKARGCIKYYNLNGLIH-IIEQLS 417

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           S+ +E   Y  A+ PW+L K++ +    VLY  +E IR + +LLQ  +P+L++K+ D + 
Sbjct: 418 SMANE---YITARVPWKLSKSDREIMKAVLYKLLEYIRCIGLLLQPVIPELSSKMLDQIN 474

Query: 479 VADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
           +   NR F      +  G +L K  +PIF + +
Sbjct: 475 LPRCNRDFSKFSIPISMGEILPKP-EPIFAKIV 506


>gi|167038518|ref|YP_001666096.1| methionyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320116914|ref|YP_004187073.1| methionyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166857352|gb|ABY95760.1| methionyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319930005|gb|ADV80690.1| methionyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 633

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/508 (45%), Positives = 337/508 (66%), Gaps = 6/508 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+  ++DISYD FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSK 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +     V+ ++EEGYFFRLS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGRQ-VERVKEEGYFFRLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTDHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K +DG++P P    E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFDGILPKPSQKEEVDDDLINTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +AIL+  F+P    KIF+ L + +
Sbjct: 418 ANKYIDETMPWVLAKDESKKERLGTVLYNLAEALRFIAILISPFMPNTPKKIFEQLGIEE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
               ++SL   L       K  + IFPR
Sbjct: 478 NLTTWESLKFSLLKVGTRVKRGEIIFPR 505


>gi|42520232|ref|NP_966147.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409970|gb|AAS14081.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 545

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 245/544 (45%), Positives = 340/544 (62%), Gaps = 41/544 (7%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T + Y N +PHIGHAY  ++ DV+ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+   +  K F D+ S +F+++A  ++  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEA+Y + E+    DG+        VQW++EE YFFRLS +Q+KLL  Y
Sbjct: 121 LDSYSGWYSVRDEAFYQESEL---IDGKAPTGAE--VQWIKEESYFFRLSNWQEKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++ P FI P  RRNEVISFV+SGL DLS+SR +F+WGIK+P + ++++YVWIDALTNYLT
Sbjct: 176 KNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNGKHVIYVWIDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFWPA----------------------------------DLHVIGKD 266
           + G+         +FW                                    ++HVIGKD
Sbjct: 236 SIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSAANLADNSFNVHVIGKD 295

Query: 267 ILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALR 326
           ILRFHA+YWPA LL+A+LPLPK++  HG+ L++GEKISKSLGNVIDPI + +E GVD LR
Sbjct: 296 ILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLR 355

Query: 327 YFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTES 386
           YFL+RE + G+DG + K  +  R+N++LAN IGNLV R++S + K   G++PT       
Sbjct: 356 YFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQSLLK 415

Query: 387 DESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAST 446
            E  L  C  +L ++  ++     +  +  +I++ SE + Y D   PW L KT+ +R + 
Sbjct: 416 GEESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRERMNL 475

Query: 447 VLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSL-DQRLKPGFMLHKTFDP 505
           V+Y  +E IR + ILLQ  VPK A  I + L +  E R  +SL D  +  G  L K   P
Sbjct: 476 VIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKSLCDACVSSGITLPKP-TP 534

Query: 506 IFPR 509
           +F R
Sbjct: 535 VFLR 538


>gi|167038739|ref|YP_001661724.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300913676|ref|ZP_07130993.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307723309|ref|YP_003903060.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|166852979|gb|ABY91388.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300890361|gb|EFK85506.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307580370|gb|ADN53769.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X513]
          Length = 632

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/509 (44%), Positives = 336/509 (66%), Gaps = 6/509 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+  ++DISYD FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSK 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +     V+ ++EEGYFFRLS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGRQ-VERVKEEGYFFRLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTDHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K + G++P P    E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFGGILPKPSQKEEVDDDLITTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +A+L+  F+P    KIF+ L V +
Sbjct: 418 ANKYIDETMPWVLAKDESKKERLGTVLYNLTEALRFIAVLISPFMPNTPKKIFEQLGVEE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
               ++SL   L       K  + IFPR 
Sbjct: 478 NLTTWESLKFGLLKEGTKVKRGEIIFPRI 506


>gi|225677328|ref|ZP_03788304.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590629|gb|EEH11880.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 541

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 247/544 (45%), Positives = 343/544 (63%), Gaps = 41/544 (7%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T + Y N +PHIGHAY  ++ DV+ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+   +  K F D+ S +F+++A  ++  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEA+Y + E+    DG+        VQW++EE YFFRLS +QDKLL  Y
Sbjct: 121 LDSYSGWYSVRDEAFYQESEL---IDGKAPTGAE--VQWIKEESYFFRLSNWQDKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++ P FI P  RRNEVISFV+SGL DLS+SR +F+WGIK+P + ++++YVWIDALTNYLT
Sbjct: 176 KNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFW-------PA---------------------------DLHVIGKD 266
           + G+         +FW       PA                           ++HVIGKD
Sbjct: 236 SIGFPSTEGEEYKRFWAESKTQIPASRAGMTPNQGKTQIPVLRAANLADSSFNVHVIGKD 295

Query: 267 ILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALR 326
           ILRFHA+YWPA LL+A+LPLPK++  HG+ L++GEKISKSLGNVIDPI + +E GVD LR
Sbjct: 296 ILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLR 355

Query: 327 YFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTES 386
           YFL+RE + G+DG + K  +  R+N++LAN IGNLV R++S + K   G++PT       
Sbjct: 356 YFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDRDLLR 415

Query: 387 DESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAST 446
            E  L  C  +L ++ +++     ++ +  +I++ SE + Y D   PW L KT+ +R + 
Sbjct: 416 GEESLPNCKAILGQVMDHLSKYEFNQIILLIINISSEANAYIDKSAPWTLSKTDRERMNL 475

Query: 447 VLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSL-DQRLKPGFMLHKTFDP 505
           V+Y  +E IR +  LLQ  VPK A  I + L +  E R  +SL D  +  G  L K   P
Sbjct: 476 VIYKLLEYIRIIGTLLQPIVPKSAEMILNQLQIPKEQRDLKSLYDTCVSSGITLPKP-TP 534

Query: 506 IFPR 509
           +F R
Sbjct: 535 VFLR 538


>gi|323706295|ref|ZP_08117861.1| methionyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534347|gb|EGB24132.1| methionyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 635

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/506 (45%), Positives = 335/506 (66%), Gaps = 6/506 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV+F TGTDEHGQKI + A+  G
Sbjct: 5   FYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRKAKEKG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           VT K +VD+     +D+ + +DIS D FIRTT+K+H +  + ++ K+ +KGDIYK  Y G
Sbjct: 65  VTPKQYVDEIVAWIKDLWNTMDISNDKFIRTTDKQHEEIVQKIFTKLYEKGDIYKSEYEG 124

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E ++ + ++    DG   +    PV+ ++EE YFF+LS Y DKLL YYE HP+F
Sbjct: 125 WYCTPCETFWTEKQL---VDGNCPDCGR-PVELVKEESYFFKLSNYADKLLKYYEEHPDF 180

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  R NE++SF+KSGL+DL +SR +FDWG+K+P DP++++YVWIDAL+NY+T  GY  
Sbjct: 181 IQPESRLNEMVSFIKSGLEDLCVSRTSFDWGVKVPFDPKHVVYVWIDALSNYITALGYST 240

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+SKS
Sbjct: 241 DHDEDFKKYWPADVHLVGKEIVRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKMSKS 300

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN  GNL+SR+V
Sbjct: 301 KGNVVDPKELVSKYGVDAIRYFLLREVPFGADGVFSNEALISRINSDLANDFGNLLSRTV 360

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +M+ K +DG++P      + D+ ++S+ + + + +   M       ALA++  LV   ++
Sbjct: 361 TMVEKYFDGVVPEVSDKDDVDDELISIANNLPKVVESYMDKLQFSNALAEIWKLVGRANK 420

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           Y D   PW L K  +   R  TVLY  VE +R +AIL+  F+P    KI++ L + D+ R
Sbjct: 421 YIDETMPWVLAKDESKKGRLKTVLYNLVESLRFVAILITPFMPNTPIKIYEQLGIDDDLR 480

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRF 510
            + SL   L       K  + IFPR 
Sbjct: 481 TWDSLKFGLLKSGTKVKRGENIFPRI 506


>gi|311028969|ref|ZP_07707059.1| methionyl-tRNA synthetase [Bacillus sp. m3-13]
          Length = 663

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/523 (43%), Positives = 344/523 (65%), Gaps = 15/523 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           + +++  YI+T I YP+   HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI +
Sbjct: 2   VADKKTFYITTPIYYPSGNLHIGHAYTTVAGDAMARYKRLKGFDVMYLTGTDEHGQKIQR 61

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  GVT++ +VD      +D+ + LDISYDDFIRTTE RH +    ++K++ D+GDIY
Sbjct: 62  KAEEKGVTSQQYVDDIVSGIKDLWEKLDISYDDFIRTTESRHKEVVEKIFKQLLDQGDIY 121

Query: 121 KGCYSGWYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQ 173
              Y GWYS+ DE YY + ++        K   G+  ++ H PV+ + E+ YFFR+  Y 
Sbjct: 122 LDEYEGWYSVPDETYYREHQLVDPIHENGKVVGGKSPDSGH-PVELVREQSYFFRMGKYV 180

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL YY+ +PEFI P  R+NE+++ F+K GL+DL++SR +FDWG+K+P DP++++YVWI
Sbjct: 181 DRLLQYYDENPEFIQPESRKNEMVNNFIKPGLEDLAVSRTSFDWGVKVPGDPKHVIYVWI 240

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL+NY+T  GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+
Sbjct: 241 DALSNYITALGYGTDNDEKYMKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFA 300

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG++L K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +RVN 
Sbjct: 301 HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVNF 360

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNL++R+V+MI K +DG +P   G  TE D+++  +    +Q     M+N    
Sbjct: 361 DLANDLGNLLNRTVAMIDKYFDGEVPVYNGNVTEFDQTLSDLAVNTVQHYENAMENMEFS 420

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKKTN--PDRASTVLYVTVEVIRQLAILLQAFVPKL 469
            AL+ +  LVS  ++Y D  +PW L K +   D+ ++ +    E +R + ILL+ F+ + 
Sbjct: 421 VALSSIWQLVSRTNKYIDETQPWVLAKNDETKDQLASAMAHLAESLRFIGILLKPFLTRT 480

Query: 470 ANKIFDILFVADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             KIF  L V +    ++SL    ++  G    K  DPIFPR 
Sbjct: 481 PGKIFAQLGVKESLTTWESLSSFGQISAGTKTVKA-DPIFPRL 522


>gi|297543649|ref|YP_003675951.1| methionyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841424|gb|ADH59940.1| methionyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 632

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/509 (44%), Positives = 336/509 (66%), Gaps = 6/509 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAK 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+  ++DISYD FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +    PV+ ++EEGYFF+LS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGR-PVERVKEEGYFFKLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTDNDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K + G++P      E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFGGILPKLSQKEEVDDDLITTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +A+L+  F+P    KIF+ L V +
Sbjct: 418 ANKYIDETMPWVLAKDESKKERLGTVLYNLTEALRFIAVLISPFMPNTPKKIFEQLGVEE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
               ++SL   L       K  + IFPR 
Sbjct: 478 NLTTWESLKFGLLKEGTKVKRGEIIFPRI 506


>gi|58698674|ref|ZP_00373565.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630227|ref|YP_002727018.1| Methionyl-tRNA synthetase [Wolbachia sp. wRi]
 gi|58534805|gb|EAL58913.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592208|gb|ACN95227.1| Methionyl-tRNA synthetase [Wolbachia sp. wRi]
          Length = 548

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 245/547 (44%), Positives = 339/547 (61%), Gaps = 44/547 (8%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T + Y N +PHIGHAY  ++ DV+ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+   +  K F D  S +F+++A  ++  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKAKEMQPKEFTDDVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEA+Y + E+    DG+        VQW++EE YFFRLS +QDKLL  Y
Sbjct: 121 LDSYSGWYSVRDEAFYQESEL---IDGKAPTGAE--VQWIKEESYFFRLSNWQDKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++ P FI P  RRNEVISFV+SGL DLS+SR +F+WGIK+P + ++++YVWIDALTNYLT
Sbjct: 176 KNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFWPA-------------------------------------DLHVI 263
           + G+         +FW                                       ++HVI
Sbjct: 236 SIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSTGMTPNLADNSFNVHVI 295

Query: 264 GKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVD 323
           GKDILRFHA+YWPA LL+A+LPLPK++  HG+ L++GEKISKSLGNVIDPI + +E GVD
Sbjct: 296 GKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVD 355

Query: 324 ALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAF 383
            LRYFL+RE + G+DG + K  +  R+N++LAN IGNLV R++S + K   G++PT    
Sbjct: 356 QLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQI 415

Query: 384 TESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDR 443
               E  L  C  +L ++  ++     +  +  +I++ SE + Y D   PW L KT+ +R
Sbjct: 416 LLKGEESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRER 475

Query: 444 ASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSL-DQRLKPGFMLHKT 502
            + V+Y  +E IR + ILLQ  VPK A  I + L +  E R  +SL +  +  G  L K 
Sbjct: 476 VNLVIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKSLCNACVSLGITLPKP 535

Query: 503 FDPIFPR 509
             P+F R
Sbjct: 536 -TPVFLR 541


>gi|58617532|ref|YP_196731.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
 gi|58417144|emb|CAI28257.1| Methionyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
          Length = 506

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/510 (45%), Positives = 329/510 (64%), Gaps = 10/510 (1%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
            +Y++T I Y N  PHIGH Y  +I+D++ARF RLDG +V F TGTDEHGQKI KAA  A
Sbjct: 3   NIYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKA 62

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
             +   F D  S  F+ +  V++ S+DDFIRTTE RH      LW+++   G IY G YS
Sbjct: 63  NKSLVEFTDHASAIFQHLTGVMNFSHDDFIRTTEIRHKKAVTELWRRLYHYGKIYLGNYS 122

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY++RDE +Y + E+    DG+        V+W+EE  YFFRLS +Q++LL +Y+ HP 
Sbjct: 123 GWYAVRDETFYQEKEL---IDGKAPTGAE--VEWVEEPSYFFRLSHFQERLLDFYDKHPN 177

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI+P  R NEVISFVKSGLKD+S+SR+   WGI +P+D  +I+YVWIDALTNYLTT G+ 
Sbjct: 178 FIIPRHRYNEVISFVKSGLKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFP 237

Query: 246 DNPDGSKAKFWPAD----LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
           +        +W  +    +HV+GKDILRFHA+YWPA L++A LPLPK++ +HG+  ++G+
Sbjct: 238 EINSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQ 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           KISKSLGNVI+P E+IEE GVD +RYFL++E+  G DG Y ++ +   +N DLAN IGNL
Sbjct: 298 KISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRNSIISCINCDLANNIGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           V R+VS++ K+  G IP   +    DE  L     +L+ +R  +    ++  +  V  L 
Sbjct: 358 VQRTVSLLHKECHGTIPNVASSLFQDEDALPNYQEILENVRICINQYNLNGVIHIVEELS 417

Query: 422 SEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           S  + Y   + PW+L KT+P     VLY  +E IR + +LLQ  +P L++KI D + +++
Sbjct: 418 SMANEYIAFRAPWKLSKTDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIALSE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
             R F +    +  G +L K  +PIF + +
Sbjct: 478 YKRSFNNFAVPIDTGIILPKP-EPIFTKII 506


>gi|172056076|ref|YP_001812536.1| methionyl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
 gi|171988597|gb|ACB59519.1| methionyl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
          Length = 651

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/509 (43%), Positives = 348/509 (68%), Gaps = 11/509 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+A+ HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A+ AG
Sbjct: 5   FYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLQGFDVRYLTGTDEHGQKIQEKAKEAG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           V+ + FVD      + + D LDISYDD+IRTTE RH +    +++ + +KGDIY G Y G
Sbjct: 65  VSEQEFVDGVVEQIKVLWDRLDISYDDYIRTTEPRHKEVVERVFETLLEKGDIYLGEYEG 124

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WYS+ DE YY + ++    DG+  ++ H PV+ + EE YFFR+S Y D+L+ YYE++P F
Sbjct: 125 WYSVPDETYYTESQL---VDGKSPDSGH-PVELVREECYFFRISQYADRLVEYYEANPSF 180

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           ILP  R++E+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVW+DALTNY+++ GY 
Sbjct: 181 ILPESRKHEMINNFIKPGLQDLAVSRTTFDWGVKVPSNPKHVVYVWVDALTNYISSLGYG 240

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            +  G+  K+WPAD+H++GK+I+RFH I WPA L++ +LPLPK+VF+HG++L K  K+SK
Sbjct: 241 TDDQGNFDKYWPADVHLVGKEIVRFHTIVWPALLMALDLPLPKQVFAHGWLLMKDGKMSK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +R+N DLAN +GNL++R+
Sbjct: 301 SKGNVVDPVPMIDRYGLDALRYYLLREVPFGSDGMFTPEAFVERMNFDLANDLGNLLNRT 360

Query: 366 VSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++MI K +DG+IPT  G  T  DE++ ++    ++++   M++     AL+ +  L+S  
Sbjct: 361 IAMITKYFDGVIPTYAGNVTPFDETLSTLAKETVEKVEAAMEHMEFSVALSHIWQLISRA 420

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           ++Y D  +PW L K  +  D  ++ +   V  +R +AI+LQ F+ +   ++F  L +  +
Sbjct: 421 NKYIDETQPWVLAKDESKTDELASSMVHLVGALRHVAIMLQPFMTRSPKEMFRQLGLEGQ 480

Query: 483 NRCFQSLDQ--RLKPGFMLHKTFDPIFPR 509
              + +L+Q   ++ G  +    +PIFPR
Sbjct: 481 PMDWTALEQFAAIEEGTKVGAA-EPIFPR 508


>gi|289577361|ref|YP_003475988.1| methionyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
 gi|289527074|gb|ADD01426.1| methionyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
          Length = 633

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/508 (44%), Positives = 335/508 (65%), Gaps = 6/508 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAK 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +++  ++DISYD FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKNLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +    PV+ ++EEGYFF+LS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGR-PVERVKEEGYFFKLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y    D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTYHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN  GNL+S
Sbjct: 298 SKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDFGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K + G++P P    E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFGGILPKPSQKEEVDDDLINTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +A+L+  F+P    KIF+ L + +
Sbjct: 418 ANKYIDETMPWVLAKDESKKERLGTVLYNLAEALRFIAVLISPFMPNTPKKIFEQLGIEE 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
               ++SL   L       K  + IFPR
Sbjct: 478 NLTTWESLKFGLLKEGTKVKRGEIIFPR 505


>gi|217966690|ref|YP_002352196.1| methionyl-tRNA synthetase [Dictyoglomus turgidum DSM 6724]
 gi|217335789|gb|ACK41582.1| methionyl-tRNA synthetase [Dictyoglomus turgidum DSM 6724]
          Length = 634

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/471 (47%), Positives = 314/471 (66%), Gaps = 5/471 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R K YI+T I Y N++PHIG  Y  I+AD  ARF+RL   DV F TG DEHGQK+A+ AQ
Sbjct: 9   RNKFYITTPIYYSNSEPHIGTVYTTIVADTFARFYRLKDYDVFFLTGLDEHGQKLARTAQ 68

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G T + +VD  ++ F +  + + I+ DDFIRTTEKRH +  + +++K+ DKG +YKG 
Sbjct: 69  ERGYTPQEYVDLMAQKFIETWEKIGITNDDFIRTTEKRHEEVVQKVFQKLYDKGYLYKGS 128

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWY    E ++  +E++ G       A   PV+W+EEE Y+F+LSA+ + LL Y E H
Sbjct: 129 YAGWYCTPCETFWQKEELHDGN----CPACGRPVEWLEEETYYFKLSAFAEPLLKYIEEH 184

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEF+ P  RRNEVISF+KSGLKD+S +R T  WGI +P DP++ +YVW DAL NY++  G
Sbjct: 185 PEFVYPETRRNEVISFIKSGLKDISATRTTVKWGIPVPFDPKHTVYVWFDALVNYISALG 244

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           YL + D    ++WPAD+H+IGKDILRFHAI WPA L++ N+PLPK V +HGF   KG KI
Sbjct: 245 YLTDDDSKFKRYWPADVHLIGKDILRFHAIIWPAILMALNIPLPKTVLAHGFWTIKGGKI 304

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GN +DP E+I   GVDALRYFL+RE+  G DG Y  +   +R ++DLAN +GNL++
Sbjct: 305 SKSKGNRVDPHELINLYGVDALRYFLLREVPLGLDGEYSDEAFHRRYHSDLANDLGNLLN 364

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R +++  K  +G +P P  F E D+ +L     +  ++ E M N     AL  +  +V E
Sbjct: 365 RVLTVAEKYTEGKVPEPKEFQEEDKFLLQKGDDMANKVEEAMANFNPANALTYIWEVVQE 424

Query: 424 VDRYFDAQKPWELKKT-NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
            +RY D Q PW L  + N DR +TV+Y  +E +R+++I+L AF+P +A +I
Sbjct: 425 ANRYIDQQAPWNLASSGNKDRLNTVIYTLLEALRKISIMLYAFMPNIAEEI 475


>gi|217965737|ref|YP_002351415.1| methionyl-tRNA synthetase [Listeria monocytogenes HCC23]
 gi|217335007|gb|ACK40801.1| methionyl-tRNA synthetase [Listeria monocytogenes HCC23]
 gi|307569716|emb|CAR82895.1| metS [Listeria monocytogenes L99]
          Length = 665

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/522 (44%), Positives = 346/522 (66%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M++     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEASMEHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SLVS  ++Y D   PW L K    RA  ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLVSRTNKYIDETAPWALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 525


>gi|57239498|ref|YP_180634.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
 gi|57161577|emb|CAH58505.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
          Length = 506

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/509 (45%), Positives = 330/509 (64%), Gaps = 10/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
           +Y++T I Y N  PHIGH Y  +I+D++ARF RLDG +V F TGTDEHGQKI KAA  A 
Sbjct: 4   IYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKAN 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            +   F D  S  F+ +A V++ S+DDFIRTTE RH      LW+++ + G IY G Y+G
Sbjct: 64  KSLVEFTDHASAIFQHLAGVMNFSHDDFIRTTEIRHKKAVTGLWRRLYNYGKIYLGNYAG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY++RDE +Y + E+    DG+        V+W+EE  YFFRLS +Q++LL +Y+ HP F
Sbjct: 124 WYAVRDETFYQEKEL---IDGKAPTGAE--VEWVEEPSYFFRLSHFQERLLDFYDKHPNF 178

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I+P  R NEVISFVKSGLKD+S+SR+   WGI +P+D  +I+YVWIDALTNYLTT G+ +
Sbjct: 179 IIPKHRYNEVISFVKSGLKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFPE 238

Query: 247 NPDGSKAKFWPAD----LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
                   +W  +    +HV+GKDILRFHA+YWPA L++A LPLPK++ +HG+  ++G+K
Sbjct: 239 INSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKSLGNVI+P E+IEE GVD +RYFL++E+  G DG Y +  +   +N DLAN IGNLV
Sbjct: 299 ISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRSSIINCINCDLANNIGNLV 358

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R+VS++ K+  G IP   +    DE  L     +L+ +R  +    ++  +  V  L S
Sbjct: 359 QRTVSLLHKECRGTIPNVASSLFQDEDALPNYQEILENVRICINQYNLNGMIHIVEELSS 418

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
             + Y   + PW+L KT+P     VLY  +E IR + +LLQ  +P L++KI D + +++ 
Sbjct: 419 IANEYIAFRAPWKLSKTDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIALSEY 478

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            R F +    +  G +L K  +PIF + +
Sbjct: 479 KRSFNNFAVPIDTGIILPKP-EPIFTKII 506


>gi|312109184|ref|YP_003987500.1| methionyl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
 gi|311214285|gb|ADP72889.1| methionyl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
          Length = 648

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/515 (45%), Positives = 345/515 (66%), Gaps = 12/515 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+   HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT+ RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQDRHKKVVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFF++S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEESYFFKMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +PEFI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDALTNY+T 
Sbjct: 178 NPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  
Sbjct: 238 LGYGTDDDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI K +DG+IPT  GA T  D  ++      +++  E M+      ALA V  L
Sbjct: 358 LHRTVAMIEKYFDGVIPTYRGAKTPFDNDLVETAKETVKQYEEAMEKMEFSVALATVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++  ++Y D  +PW L K  +  ++ ++V+    E +R +AILLQ F+ +  +KIF  L 
Sbjct: 418 INRTNKYIDETQPWVLAKEESQKEQLASVMTHLAESLRHVAILLQPFLTRTPDKIFAQLG 477

Query: 479 VADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           + DE+ + + SL +   +K G  + K  DP+FPR 
Sbjct: 478 IVDESLKQWDSLYEFGLIKEGTKVAKG-DPLFPRL 511


>gi|58584456|ref|YP_198029.1| methionyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418772|gb|AAW70787.1| Methionyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 540

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 246/544 (45%), Positives = 341/544 (62%), Gaps = 41/544 (7%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T I Y N +PHIGHAY  +I DV ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFENFYITTPIYYVNDKPHIGHAYTSLICDVTARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+  K F D+ S +FR +A+ +D  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKTKGMHPKEFTDKVSVSFRKLAEFIDFQYDDFIRTTEERHEKAVVALWDRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+ DEA+Y + E+    DG+        V+W++EE YFFRLS++Q+KLL  Y
Sbjct: 121 LDSYSGWYSVSDEAFYQESEL---IDGKAPTGAE--VEWVKEESYFFRLSSWQNKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++ P FI P  R+NEVISFVKSGL DLS+SR +F+WGIK+P + ++I+YVW+DALTNYLT
Sbjct: 176 KNQPNFIFPESRKNEVISFVKSGLTDLSISRISFNWGIKVPRNDKHIIYVWVDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFWPA----------------------------------DLHVIGKD 266
           + G+ +  +    KFW                                    ++HVIGKD
Sbjct: 236 SIGFPNTENEEYKKFWAESQSVIQVADTWIQKEIQISASRARMTSNLADNSFNIHVIGKD 295

Query: 267 ILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALR 326
           ILRFHA+YWPA LL+A+LPLPK++  HG+ L++G+KISKSLGNVIDPI + +E GVD LR
Sbjct: 296 ILRFHAVYWPAILLAADLPLPKQIVVHGWWLNEGKKISKSLGNVIDPIALAKEFGVDQLR 355

Query: 327 YFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTES 386
           YFL+RE + G+DG + K  +  R+N++LAN IGNLV R++S + K   G++PT       
Sbjct: 356 YFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKRCFGVVPTVDKSLLK 415

Query: 387 DESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAST 446
            E  L     +  ++ +++     +  +  +I++ SE + Y D   PW L KT+ +R + 
Sbjct: 416 GEEGLPNYRAIFNQVMDHLSKYEFNHIILLIINISSEANAYIDKSAPWILSKTDRERMNL 475

Query: 447 VLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSL-DQRLKPGFMLHKTFDP 505
           V+Y  +E IR + ILLQ  VP+ A  I D L +  E R  +SL    +  G  LHK   P
Sbjct: 476 VIYKLLEYIRIIGILLQPIVPRPAEVILDQLQIPKEQRDLKSLCGAYVSSGTTLHKP-TP 534

Query: 506 IFPR 509
           +F R
Sbjct: 535 VFLR 538


>gi|290892267|ref|ZP_06555262.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J2-071]
 gi|290558093|gb|EFD91612.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J2-071]
          Length = 664

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/522 (44%), Positives = 346/522 (66%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M++     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEASMEHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SLVS  ++Y D   PW L K    RA  ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLVSRTNKYIDETAPWALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|307265681|ref|ZP_07547234.1| methionyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389218|ref|ZP_08210786.1| methionyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|306919325|gb|EFN49546.1| methionyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994581|gb|EGD53005.1| methionyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 633

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/509 (44%), Positives = 336/509 (66%), Gaps = 6/509 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G DV F TGTDEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAR 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K +VD      +D+   +DIS D FIRTT+K H +  + ++ K+ +KGDIYK  
Sbjct: 62  EKGMSPKEYVDGIVEWIKDLWKTMDISNDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ + ++    DG+  +    PV+ ++EEGYFF+LS Y D+LL YY+ H
Sbjct: 122 YEGWYCTPCESFWTESQL---VDGKCPDCGR-PVERVKEEGYFFKLSKYGDRLLQYYDEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 178 PDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPRHVIYVWIDALSNYITALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++ +G K+
Sbjct: 238 YSTDHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVVDPKELVRKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K ++G++P P    E D+ +++    + + + E M       AL ++  LV  
Sbjct: 358 RTVTMIEKYFEGILPKPSQKEEVDDDLINTAQNLPKTVEEYMDKLQFSNALIEIWKLVRR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  +  +R  TVLY   E +R +AIL+  F+P    K+F+ L +  
Sbjct: 418 ANKYIDETMPWILAKDESKKERLGTVLYNLAEALRFIAILISPFMPNTPQKMFEQLGIEK 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           +   ++SL   L       K  + IFPR 
Sbjct: 478 DLTTWESLKFGLLKEGTKVKRGEIIFPRI 506


>gi|255022653|ref|ZP_05294639.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J1-208]
          Length = 619

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/522 (44%), Positives = 346/522 (66%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +E+YK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEIYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M++     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEASMEHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SLVS  ++Y D   PW L K    RA  ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLVSRTNKYIDETAPWALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|295401997|ref|ZP_06811959.1| methionyl-tRNA synthetase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294975999|gb|EFG51615.1| methionyl-tRNA synthetase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 648

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/515 (44%), Positives = 345/515 (66%), Gaps = 12/515 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+   HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT+ RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQDRHKKVVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFF++S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEESYFFKMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +PEFI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDALTNY+T 
Sbjct: 178 NPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  
Sbjct: 238 LGYGTDDDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI K +DG+IPT  GA T  D  ++      +++  E M+      ALA V  L
Sbjct: 358 LHRTVAMIEKYFDGVIPTYRGAKTPFDNDLVETAKETVKQYEEAMEKMEFSVALATVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++  ++Y D  +PW L K  +  ++ ++V+    E +R +AILLQ F+ +  +KIF  L 
Sbjct: 418 INRTNKYIDETQPWVLAKEESQKEQLASVMTHLAESLRHVAILLQPFLTRTPDKIFAQLG 477

Query: 479 VADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           + DE+ + + SL +   +K G  + K  +P+FPR 
Sbjct: 478 IVDESLKQWDSLYEFGLIKEGTKVAKG-EPLFPRL 511


>gi|239825617|ref|YP_002948241.1| methionyl-tRNA synthetase [Geobacillus sp. WCH70]
 gi|239805910|gb|ACS22975.1| methionyl-tRNA synthetase [Geobacillus sp. WCH70]
          Length = 648

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/515 (45%), Positives = 344/515 (66%), Gaps = 12/515 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVEGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEESYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +PEFI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDALTNY+T 
Sbjct: 178 NPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           ++R+V+MI K +DGMIP   GA T  D  ++      +++  E M+      ALA V  L
Sbjct: 358 LNRTVAMIEKYFDGMIPPYRGAKTAFDNDLVEKAKETVKQYEEAMEKMEFSIALASVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++  ++Y D  +PW L K     ++ ++V+    E +R +AILLQ F+ +   KIF  L 
Sbjct: 418 INRTNKYIDETQPWLLAKDEGKKEQLASVMTHLAESLRHVAILLQPFLTRTPEKIFAQLG 477

Query: 479 VADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           + DE  + + SL +   +K G  + K  +P+FPR 
Sbjct: 478 IVDEQLKQWDSLYEFGLIKEGTKVTKG-EPLFPRL 511


>gi|58579479|ref|YP_197691.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
 gi|58418105|emb|CAI27309.1| Methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
          Length = 506

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/509 (45%), Positives = 329/509 (64%), Gaps = 10/509 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
           +Y++T I Y N  PHIGH Y  +I+D++ARF RLDG +V F TGTDEHGQKI KAA  A 
Sbjct: 4   IYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKAN 63

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            +   F D  S  F+ +  V++ S+DDFIRTTE RH      LW+++ + G IY G Y+G
Sbjct: 64  KSLVEFTDHASAIFQHLTGVMNFSHDDFIRTTEIRHKKAVTGLWRRLYNYGKIYLGNYAG 123

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY++RDE +Y + E+    DG+        V+W+EE  YFFRLS +Q++LL +Y+ HP F
Sbjct: 124 WYAVRDETFYQEKEL---IDGKAPTGAE--VEWVEEPSYFFRLSHFQERLLDFYDKHPNF 178

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I+P  R NEVISFVKSGLKD+S+SR+   WGI +P+D  +I+YVWIDALTNYLTT G+ +
Sbjct: 179 IIPKHRYNEVISFVKSGLKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFPE 238

Query: 247 NPDGSKAKFWPAD----LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
                   +W  +    +HV+GKDILRFHA+YWPA L++A LPLPK++ +HG+  ++G+K
Sbjct: 239 INSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKSLGNVI+P E+IEE GVD +RYFL++E+  G DG Y +  +   +N DLAN IGNLV
Sbjct: 299 ISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRSSIINCINCDLANNIGNLV 358

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R+VS++ K+  G IP   +    DE  L     +L+ +R  +    ++  +  V  L S
Sbjct: 359 QRTVSLLHKECRGTIPNVASSLFQDEDALPNYQEILENVRICINQYNLNGMIHIVEELSS 418

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
             + Y   + PW+L KT+P     VLY  +E IR + +LLQ  +P L++KI D + +++ 
Sbjct: 419 IANEYIAFRAPWKLSKTDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIALSEY 478

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            R F +    +  G +L K  +PIF + +
Sbjct: 479 KRSFNNFAVPIDTGIILPKP-EPIFTKII 506


>gi|254456247|ref|ZP_05069676.1| methionyl-tRNA synthetase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083249|gb|EDZ60675.1| methionyl-tRNA synthetase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 494

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/470 (46%), Positives = 323/470 (68%), Gaps = 1/470 (0%)

Query: 22  IGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFR 81
           +GHAY  IIAD  ARF ++DG +V F TGTDEHG KI +AA+   + T  F DQ S+ FR
Sbjct: 1   MGHAYSSIIADFFARFKKMDGFNVYFLTGTDEHGLKIQRAAEKQNIDTLEFCDQISQTFR 60

Query: 82  DMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEV 141
           +++  L+++  DFIRTTE+RH  T + LWK++     IY   YSGWYS+ DEA+YNDDE+
Sbjct: 61  NLSKTLNLTNTDFIRTTEERHKKTVQYLWKELEKNDYIYLSKYSGWYSVSDEAFYNDDEI 120

Query: 142 YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVK 201
               + +   +  + V+W+EEE YFFRLS ++  LL YY+SHP+FI P  RRNEVISFVK
Sbjct: 121 ETIDENKVAISSKSKVEWIEEESYFFRLSKWEKPLLDYYKSHPDFIAPESRRNEVISFVK 180

Query: 202 SGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLH 261
           SGLKDLS+SRK+F WGIK+P++  +++YVW+DALTNYL+   + +  D     FWPA +H
Sbjct: 181 SGLKDLSVSRKSFSWGIKVPNNNDHVIYVWLDALTNYLSALNFPNANDELFKNFWPASIH 240

Query: 262 VIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVG 321
           +IGKDILRFHA+YWPAFLL+A + LP KV+ HG+IL   EK+SKS GN++DP+E+I+E G
Sbjct: 241 LIGKDILRFHAVYWPAFLLAAKIELPTKVYGHGWILSDNEKMSKSKGNILDPLEIIKEYG 300

Query: 322 VDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPG 381
           +D LRY+L++E++ G DG   ++ L+  +N+DLAN  GNL  R  +  +K+ +  IP   
Sbjct: 301 LDPLRYYLIKEVSFGNDGNISQERLEDCINSDLANNFGNLCQRVTAFAIKNCESKIPKQI 360

Query: 382 AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNP 441
            F + D  IL+     L+ IRE + NQ I+  +  +I+ + E ++YF+ Q+PW+ KK + 
Sbjct: 361 DFQKEDLEILNKYMNNLENIREKIDNQDINFYIDYIINSLFEANKYFNDQEPWK-KKDDQ 419

Query: 442 DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQ 491
            R +T++Y T+E++R+++ LL   +P  + K   I  + +++  F S++ 
Sbjct: 420 LRLNTIVYTTLEIVRKISFLLFPIIPNSSLKALKIFNLTEKDINFSSIEN 469


>gi|228989246|ref|ZP_04149239.1| Methionyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
 gi|228770456|gb|EEM19027.1| Methionyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
          Length = 660

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/524 (44%), Positives = 345/524 (65%), Gaps = 18/524 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI K 
Sbjct: 3   EENKTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH +    ++K++ D+GDIY 
Sbjct: 63  AEELQVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H  V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWGI++P +P++++YVW+D
Sbjct: 182 RLLQFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  + +    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTDNEEKYKKYWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L++I E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAQGTLKKIEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    E++RQ+AI+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDRDKLASVMAHLAEMLRQMAIMLMPFLTATP 481

Query: 471 NKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           +KIF  L + DE   +QS D     G +   T      PIFPR 
Sbjct: 482 SKIFTQLGLTDE--AYQSWDSLSTIGCIPASTKVVKGQPIFPRL 523


>gi|116871573|ref|YP_848354.1| methionyl-tRNA synthetase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116740451|emb|CAK19571.1| methionyl-tRNA synthetase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 665

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 345/522 (66%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++  +GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLAQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +IE  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIERYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  T+ D++++   + V++E  ++M++     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTDFDQTLVDFKNNVVEEYEKSMEHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAPWTLAKEEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 525


>gi|152973886|ref|YP_001373403.1| methionyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152022638|gb|ABS20408.1| methionyl-tRNA synthetase [Bacillus cytotoxicus NVH 391-98]
          Length = 659

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/524 (43%), Positives = 342/524 (65%), Gaps = 18/524 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E++  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI K 
Sbjct: 3   EEKKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +D+ + +DISYDDFIRTTE RH +    ++K++ D+GDIY 
Sbjct: 63  AEELQVTPQAYVDDIVAGIKDLWNKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y + ++        K   G+  ++ H  V+ + E  YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMENGKVVGGKSPDSGH-AVELVREASYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWGI++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY         KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENAEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG IP      TE DE++++  +  LQ++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFDGQIPAFKEKVTEFDEALVNFATDTLQKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +   +S  ++Y D  +PW L K   DR   ++V+    E++RQ +I+L  F+   +
Sbjct: 422 ALSSIWQFISRTNKYIDETQPWVLAKDEKDREKLASVMAHLAEMLRQTSIMLMPFLTTTS 481

Query: 471 NKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
            KIF+ L + DE   +QS +     G +   T      PIFPR 
Sbjct: 482 GKIFEQLGITDE--AYQSWESLSTIGCIPTGTKVVKGQPIFPRL 523


>gi|228983294|ref|ZP_04143508.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229153817|ref|ZP_04281948.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gi|228629621|gb|EEK86317.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gi|228776408|gb|EEM24760.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 660

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/523 (43%), Positives = 348/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           NK+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 NKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|218291061|ref|ZP_03495093.1| methionyl-tRNA synthetase [Alicyclobacillus acidocaldarius LAA1]
 gi|218239015|gb|EED06221.1| methionyl-tRNA synthetase [Alicyclobacillus acidocaldarius LAA1]
          Length = 650

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/512 (45%), Positives = 328/512 (64%), Gaps = 9/512 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I YPN + HIGHAY  + AD +AR+ RL G DV F TGTDEHG KI + A+
Sbjct: 2   KPTFYVTTPIYYPNDKLHIGHAYTTVAADAIARYKRLRGYDVFFLTGTDEHGLKIQQRAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG+  K F+D      +D+   LDISYDDFIRTTE RH      +++++  +GDIY   
Sbjct: 62  QAGLEPKAFLDPIIAWIQDLWRKLDISYDDFIRTTELRHERVVEQIFERLLQQGDIYLSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+Y+ + E+ +G   Q        VQ++ EE YFFR+S Y D+LL YYE +
Sbjct: 122 YQGWYCTPCESYWAERELVEGKCPQC----GREVQFVREESYFFRMSKYVDRLLQYYEEN 177

Query: 184 PEFILPIERRNEVI-SFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P FI P+ R+ E+I +F++ GL+DL +SR +FDWG+ +P +P++++YVW+DAL NY++  
Sbjct: 178 PGFIEPVSRKTEMIKNFIEPGLQDLCVSRTSFDWGVHVPSNPKHVVYVWLDALVNYISAI 237

Query: 243 GYLDNPDGSKAKF---WPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           GYL +    +AKF   WPAD+HV+GKDI+RFHA+YWP  L++  LPLPKKVF HGF L K
Sbjct: 238 GYLSDDPNERAKFERYWPADVHVVGKDIVRFHAVYWPIILMALGLPLPKKVFGHGFFLVK 297

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           G K+SKS GNVIDP+ +++  G DA RYFL+REI  G+DG +  +G+ +R+N DLAN  G
Sbjct: 298 GGKMSKSKGNVIDPLSLVDRYGRDAFRYFLLREIPFGQDGTFTPEGMVERLNYDLANDFG 357

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NLV R+ +M+ +  DG++PTPG+ T+ D ++  + +    ++ ENM       ALA++ +
Sbjct: 358 NLVHRTAAMLNRFNDGVVPTPGSLTDVDRALRELAAEAKAKVEENMDQLQFSVALAELWN 417

Query: 420 LVSEVDRYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           LV   ++Y D  +PW+L K    DR +TVLY  VE IR  AIL+Q F+      I +   
Sbjct: 418 LVRAANKYIDDCQPWKLNKEGQRDRLATVLYHMVEAIRVSAILVQPFMTDAPRAIREQFG 477

Query: 479 VADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             DE   + S +  L P        +P+FPR 
Sbjct: 478 WGDEAFAWDSAEMGLGPSGQKVAEREPLFPRL 509


>gi|229074100|ref|ZP_04207147.1| Methionyl-tRNA synthetase [Bacillus cereus Rock4-18]
 gi|228708994|gb|EEL61120.1| Methionyl-tRNA synthetase [Bacillus cereus Rock4-18]
          Length = 660

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/522 (43%), Positives = 346/522 (66%), Gaps = 14/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y      D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     LQ++ + M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKNTLQKVEDAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKGENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E ++ ++SL      PG    +  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHKSWESLSTIGCIPGGTKVEKGNPIFPRL 523


>gi|228995429|ref|ZP_04155099.1| Methionyl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gi|228764290|gb|EEM13167.1| Methionyl-tRNA synthetase [Bacillus mycoides Rock3-17]
          Length = 660

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/524 (43%), Positives = 345/524 (65%), Gaps = 18/524 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI K 
Sbjct: 3   EENKTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT++ +VD      +++ + +DISYDDFIRTTE RH +    ++K++ D+GDIY 
Sbjct: 63  AEELQVTSQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H  V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWGI++P +P++++YVW+D
Sbjct: 182 RLLQFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  + +    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTDNEEKYKKYWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    E++RQ+ I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDRDKLASVMAHLAEMLRQMGIMLMPFLTATP 481

Query: 471 NKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           +KIF  L + DE   +QS D     G +   T      PIFPR 
Sbjct: 482 SKIFTQLGLTDE--AYQSWDSLSTIGCIPASTKVVKGQPIFPRL 523


>gi|229542295|ref|ZP_04431355.1| methionyl-tRNA synthetase [Bacillus coagulans 36D1]
 gi|229326715|gb|EEN92390.1| methionyl-tRNA synthetase [Bacillus coagulans 36D1]
          Length = 655

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/516 (44%), Positives = 339/516 (65%), Gaps = 11/516 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           ++R+  YI+T I YP+   HIGHAY  +  D +AR+ RL G DV+F TGTDEHGQKI + 
Sbjct: 3   EKRKTFYITTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGFDVMFLTGTDEHGQKIQRK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  GVT + +VD+     +D+   L+IS DDFIRTT+ RH      ++KK+ D+GDIY 
Sbjct: 63  AKEKGVTPQQYVDEIVAGIQDLWKKLEISNDDFIRTTQDRHKKAVEKIFKKLLDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           G Y GWY    E+++ + ++    DG+  +    PV+ ++EE YFF++  Y D+LL YYE
Sbjct: 123 GEYEGWYCTPCESFFTERQL---VDGKCPDCGR-PVEKVKEESYFFKMGKYVDRLLQYYE 178

Query: 182 SHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
            +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDALTNY+T
Sbjct: 179 ENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYIT 238

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY  + D +  K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF+HG++L K 
Sbjct: 239 ALGYGSDDDSNYRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFAHGWLLMKD 298

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS GNVIDP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GN
Sbjct: 299 GKMSKSKGNVIDPVTLIDRYGLDALRYYLLREVPFGADGIFTPEGFVERINFDLANDLGN 358

Query: 361 LVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           L++R+++M+ + +DG+IPT  G+       +++     +++  + M+N     ALA +  
Sbjct: 359 LLNRTIAMMNQYFDGVIPTFAGSHNPYSIQLVTAYKEAVKKYEDAMENMQFSVALASLWE 418

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
            VS  ++Y D   PW L K    RA  + V+    E +R +AILLQ F+     KIFD L
Sbjct: 419 FVSRTNKYIDETTPWTLAKDETKRADLAEVMVHLAESLRHIAILLQPFLTSTPKKIFDQL 478

Query: 478 FVADEN-RCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
            + DE+   ++SL     +  G  + K   PIFPR 
Sbjct: 479 NITDESLHTWESLSLFGSIPEGTKVVKKGKPIFPRL 514


>gi|16799293|ref|NP_469561.1| methionyl-tRNA synthetase [Listeria innocua Clip11262]
 gi|25009380|sp|Q92F90|SYM_LISIN RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|16412635|emb|CAC95449.1| methionyl-tRNA synthetase [Listeria innocua Clip11262]
          Length = 664

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLISRTNKYIDETAPWALAKEEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPEGTTVVKKGTPIFPRL 524


>gi|229094760|ref|ZP_04225766.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-29]
 gi|229100827|ref|ZP_04231642.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-28]
 gi|229113713|ref|ZP_04243149.1| Methionyl-tRNA synthetase [Bacillus cereus Rock1-3]
 gi|228669710|gb|EEL25116.1| Methionyl-tRNA synthetase [Bacillus cereus Rock1-3]
 gi|228682594|gb|EEL36656.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-28]
 gi|228688628|gb|EEL42500.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-29]
          Length = 660

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/522 (43%), Positives = 346/522 (66%), Gaps = 14/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y      D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     LQ++ + M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLQKVEDAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E ++ ++SL      PG    +  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHKSWESLSTIGCIPGGTKVEKGNPIFPRL 523


>gi|313621117|gb|EFR92184.1| methionyl-tRNA synthetase [Listeria innocua FSL S4-378]
          Length = 657

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAPWALAKEEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPEGTTVVKKGTPIFPRL 525


>gi|206900100|ref|YP_002251787.1| methionyl-tRNA synthetase [Dictyoglomus thermophilum H-6-12]
 gi|206739203|gb|ACI18261.1| methionyl-tRNA synthetase [Dictyoglomus thermophilum H-6-12]
          Length = 628

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/471 (46%), Positives = 311/471 (66%), Gaps = 5/471 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R K YI+T I Y N++PHIG  Y  I+AD  ARF+RL   DV F TG DEHGQK+A+ AQ
Sbjct: 2   RNKFYITTPIYYSNSEPHIGTVYTTIVADTFARFYRLKDYDVFFLTGLDEHGQKLARTAQ 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G   + +VD  ++ F +    + I+ DDFIRTT+KRH +  + +++K+ D+G +YKG 
Sbjct: 62  EKGYMPQEYVDMMAQKFLETWKKIGITNDDFIRTTQKRHEEVVQKVFQKLYDEGYLYKGS 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWY    E ++  ++++ G       +   PV+W+EEE Y+F+LSA+ + LL Y E H
Sbjct: 122 YAGWYCTPCETFWQKEDLHDGN----CPSCGRPVEWLEEETYYFKLSAFAEPLLKYIEEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEF+ P  RRNEVISF+KSGLKD+S +R T  WG+ +P DP++ +YVW DAL NY++  G
Sbjct: 178 PEFVYPETRRNEVISFIKSGLKDISATRTTVKWGVPVPFDPKHTVYVWFDALVNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           YL N D    ++WPAD+H+IGKDILRFHAI WPA L++ N+PLPK V +HGF   KG KI
Sbjct: 238 YLTNDDTKFKRYWPADIHLIGKDILRFHAIIWPAILMALNIPLPKTVLAHGFWTIKGGKI 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GN +DP E+I   GVDALRYFL+RE+  G DG Y  +   +R ++DLAN +GNLV+
Sbjct: 298 SKSKGNRVDPHELINLYGVDALRYFLLREVPLGLDGEYSDEAFHRRYHSDLANDLGNLVN 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R +++  K  +G +P P  F E D  +L     V  ++ E M N     AL Q+  ++ E
Sbjct: 358 RVLTVAEKYTEGKVPEPKEFKEEDTYLLQKGEDVANKVEEAMANFNPANALTQIWEVIQE 417

Query: 424 VDRYFDAQKPWELKKT-NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
            +RY D Q PW L  + + DR +TV+Y  +E +R+++I+L AF+P  A +I
Sbjct: 418 ANRYIDQQAPWNLASSGDNDRLNTVIYTLLETLRKISIMLYAFIPNTAEEI 468


>gi|304315621|ref|YP_003850766.1| methionyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777123|gb|ADL67682.1| methionyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 636

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/506 (44%), Positives = 331/506 (65%), Gaps = 6/506 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI++ I YP+ + HIGH+Y  + AD +ARF RL G DV+F TGTDEHGQKI + A+  G
Sbjct: 5   FYITSPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRKAKEKG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           VT K +VD+     +D+   +DIS D FIRTT+K+H +  + ++ K+ +KGDIYK  Y G
Sbjct: 65  VTPKQYVDEIVAWIKDLWKTMDISNDKFIRTTDKQHEEIVQKIFTKLYEKGDIYKSEYEG 124

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E ++ + ++    DG   +    PV+ ++EE YFF+LS Y DKLL YYE HP+F
Sbjct: 125 WYCTPCETFWTEKQL---VDGNCPDCGR-PVELVKEESYFFKLSNYADKLLKYYEEHPDF 180

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  R NE++SF+KSGL+DL +SR +FDWG+K+P DP++++YVWIDAL+NY+T  GY  
Sbjct: 181 IQPESRLNEMVSFIKSGLEDLCVSRTSFDWGVKVPFDPKHVVYVWIDALSNYITALGYST 240

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           + D    K+WPAD+H++GK+I+RFH I WPA L++ +LPLPKKVF HG+++  G K+SKS
Sbjct: 241 DHDEDFKKYWPADVHLVGKEIVRFHTIIWPAMLMALDLPLPKKVFGHGWLILDGGKMSKS 300

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP E++ + GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN  GNL+SR+V
Sbjct: 301 KGNVVDPKELVSKYGVDAIRYFLLREVPFGADGVFSNEALISRINSDLANDFGNLLSRTV 360

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +M+ K +DG++P        D+ ++S+ + + + +   M       ALA++  LV   ++
Sbjct: 361 TMVEKYFDGVVPEASDKDNVDDELISIANDLPKIVEGYMDRLQFSNALAEIWKLVGRANK 420

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           Y D   PW L K  +   R   VLY  VE +R +A+L+  F+P    KI++ L + D+ R
Sbjct: 421 YIDETMPWVLAKDESKKGRLKAVLYNLVESLRFVAVLITPFMPNTPIKIYEQLGIDDDLR 480

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPRF 510
            + SL   L       K  + IFPR 
Sbjct: 481 TWASLKFGLLKAGTKVKRGENIFPRI 506


>gi|229003043|ref|ZP_04160900.1| Methionyl-tRNA synthetase [Bacillus mycoides Rock1-4]
 gi|228758201|gb|EEM07389.1| Methionyl-tRNA synthetase [Bacillus mycoides Rock1-4]
          Length = 627

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/524 (43%), Positives = 345/524 (65%), Gaps = 18/524 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI K 
Sbjct: 3   EENKTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT++ +VD      +++ + +DISYDDFIRTTE RH +    ++K++ D+GDIY 
Sbjct: 63  AEELQVTSQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H  V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWGI++P +P++++YVW+D
Sbjct: 182 RLLQFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  + +    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTDNEEKYKKYWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    E++RQ+ I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDRDKLASVMAHLAEMLRQMGIMLMPFLTATP 481

Query: 471 NKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           +KIF  L + DE   +QS D     G +   T      PIFPR 
Sbjct: 482 SKIFTQLGLTDE--AYQSWDSLSTIGCIPASTKVVKGQPIFPRL 523


>gi|226222806|ref|YP_002756913.1| methionyl-tRNA synthetase [Listeria monocytogenes Clip81459]
 gi|254992034|ref|ZP_05274224.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J2-064]
 gi|225875268|emb|CAS03965.1| methionyl-tRNA synthetase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
          Length = 664

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|254825910|ref|ZP_05230911.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J1-194]
 gi|254853705|ref|ZP_05243053.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL R2-503]
 gi|255519716|ref|ZP_05386953.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J1-175]
 gi|300764921|ref|ZP_07074910.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N1-017]
 gi|258607084|gb|EEW19692.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL R2-503]
 gi|293595148|gb|EFG02909.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J1-194]
 gi|300514408|gb|EFK41466.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N1-017]
          Length = 664

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|46906409|ref|YP_012798.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365]
 gi|67461803|sp|Q724N6|SYM_LISMF RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|46879673|gb|AAT02975.1| methionyl-tRNA synthetase [Listeria monocytogenes serotype 4b str.
           F2365]
          Length = 665

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 525


>gi|254933016|ref|ZP_05266375.1| methionyl-tRNA synthetase [Listeria monocytogenes HPB2262]
 gi|293584575|gb|EFF96607.1| methionyl-tRNA synthetase [Listeria monocytogenes HPB2262]
 gi|328469714|gb|EGF40636.1| methionyl-tRNA synthetase [Listeria monocytogenes 220]
          Length = 664

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|313625533|gb|EFR95248.1| methionyl-tRNA synthetase [Listeria innocua FSL J1-023]
          Length = 655

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D++++   + V++E   +M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPEGTTVVKKGTPIFPRL 525


>gi|218895174|ref|YP_002443585.1| methionyl-tRNA synthetase [Bacillus cereus G9842]
 gi|218546007|gb|ACK98401.1| methionyl-tRNA synthetase [Bacillus cereus G9842]
          Length = 660

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 348/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ+ I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQIGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|299820707|ref|ZP_07052596.1| methionine--tRNA ligase [Listeria grayi DSM 20601]
 gi|299817728|gb|EFI84963.1| methionine--tRNA ligase [Listeria grayi DSM 20601]
          Length = 663

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/522 (44%), Positives = 343/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   KEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT++RH    + +++++ ++GDIY 
Sbjct: 63  AKEQGISEQQYVDEVAEGFQELWKKLEISNTDFIRTTQERHKTGVQAIFERLVEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDD---EVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +    EVY+   G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLAEVYRDEAGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK +F HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVHIVGKEIIRFHTIYWPIILMALDLPLPKMIFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  T  D+++ +    V +E  +NM++     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGDVTPFDDALRTFKDDVAKEYEKNMEHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLAN 471
           L ++ SL+S  ++Y D  +PW L K  +     ++V+    E +R +AILLQ F+ +   
Sbjct: 423 LTKLWSLISRTNKYIDETEPWALAKDESRKKELASVMTHLAESLRTIAILLQPFLTRAPG 482

Query: 472 KIFDILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +IF  L +  EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFMQLGLQAENLKKWDSIYTFGAIPDGTKVVKKGTPIFPRL 524


>gi|228963136|ref|ZP_04124306.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228796521|gb|EEM43959.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar sotto
           str. T04001]
          Length = 563

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|75759600|ref|ZP_00739686.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA
           [Bacillus thuringiensis serovar israelensis ATCC 35646]
 gi|74492891|gb|EAO56021.1| Methionyl-tRNA synthetase  / Protein secretion chaperonin CsaA
           [Bacillus thuringiensis serovar israelensis ATCC 35646]
          Length = 669

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 12  EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 71

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 72  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 131

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 132 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 190

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 191 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 250

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 251 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 310

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 311 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 370

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 371 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 430

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 431 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 490

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 491 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 532


>gi|228918989|ref|ZP_04082369.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228840638|gb|EEM85899.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 660

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVSGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|228898792|ref|ZP_04063075.1| Methionyl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
 gi|228860817|gb|EEN05194.1| Methionyl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
          Length = 660

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|218235634|ref|YP_002364888.1| methionyl-tRNA synthetase [Bacillus cereus B4264]
 gi|218163591|gb|ACK63583.1| methionine--tRNA ligase [Bacillus cereus B4264]
          Length = 660

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|289433525|ref|YP_003463397.1| Methionyl-tRNA synthetase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169769|emb|CBH26305.1| metS [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313639884|gb|EFS04591.1| methionyl-tRNA synthetase [Listeria seeligeri FSL S4-171]
          Length = 665

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 344/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  T   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKLTVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPSNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK +F HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMIFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    R+N DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFIDRMNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   GA T  DE+++   + V+ +  ++M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGAVTPFDETLVDFKNNVVADYEKSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SLVS  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLVSRTNKYIDETAPWALAKDEEKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTNVVKKGTPIFPRL 525


>gi|16802223|ref|NP_463708.1| methionyl-tRNA synthetase [Listeria monocytogenes EGD-e]
 gi|224500370|ref|ZP_03668719.1| methionyl-tRNA synthetase [Listeria monocytogenes Finland 1988]
 gi|224503503|ref|ZP_03671810.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL R2-561]
 gi|254829268|ref|ZP_05233955.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N3-165]
 gi|254832524|ref|ZP_05237179.1| methionyl-tRNA synthetase [Listeria monocytogenes 10403S]
 gi|254901038|ref|ZP_05260962.1| methionyl-tRNA synthetase [Listeria monocytogenes J0161]
 gi|254913894|ref|ZP_05263906.1| methionyl-tRNA synthetase [Listeria monocytogenes J2818]
 gi|254938315|ref|ZP_05270012.1| methionyl-tRNA synthetase [Listeria monocytogenes F6900]
 gi|255026302|ref|ZP_05298288.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J2-003]
 gi|255029121|ref|ZP_05301072.1| methionyl-tRNA synthetase [Listeria monocytogenes LO28]
 gi|25009372|sp|Q8YAF2|SYM_LISMO RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|16409534|emb|CAC98392.1| methionyl-tRNA synthetase [Listeria monocytogenes EGD-e]
 gi|258601679|gb|EEW15004.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N3-165]
 gi|258610927|gb|EEW23535.1| methionyl-tRNA synthetase [Listeria monocytogenes F6900]
 gi|293591911|gb|EFG00246.1| methionyl-tRNA synthetase [Listeria monocytogenes J2818]
          Length = 664

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 343/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 3   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 63  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 183 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 243 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 303 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D+ ++   + V++E   +M +     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQILVDFKNNVVKEYEGSMDHMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 423 LNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 482

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 483 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 524


>gi|47096170|ref|ZP_00233769.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854]
 gi|284803084|ref|YP_003414949.1| methionyl-tRNA synthetase [Listeria monocytogenes 08-5578]
 gi|284996225|ref|YP_003417993.1| methionyl-tRNA synthetase [Listeria monocytogenes 08-5923]
 gi|47015418|gb|EAL06352.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854]
 gi|284058646|gb|ADB69587.1| methionyl-tRNA synthetase [Listeria monocytogenes 08-5578]
 gi|284061692|gb|ADB72631.1| methionyl-tRNA synthetase [Listeria monocytogenes 08-5923]
          Length = 665

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 343/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   G  TE D+ ++   + V++E   +M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQILVDFKNNVVKEYEGSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 525


>gi|228956480|ref|ZP_04118277.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229039943|ref|ZP_04189708.1| Methionyl-tRNA synthetase [Bacillus cereus AH676]
 gi|229142844|ref|ZP_04271287.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gi|229148448|ref|ZP_04276705.1| Methionyl-tRNA synthetase [Bacillus cereus m1550]
 gi|296500870|ref|YP_003662570.1| methionyl-tRNA synthetase [Bacillus thuringiensis BMB171]
 gi|228634990|gb|EEK91562.1| Methionyl-tRNA synthetase [Bacillus cereus m1550]
 gi|228640607|gb|EEK96994.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gi|228727402|gb|EEL78594.1| Methionyl-tRNA synthetase [Bacillus cereus AH676]
 gi|228803170|gb|EEM49991.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|296321922|gb|ADH04850.1| methionyl-tRNA synthetase [Bacillus thuringiensis BMB171]
          Length = 660

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|258510147|ref|YP_003183581.1| methionyl-tRNA synthetase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257476873|gb|ACV57192.1| methionyl-tRNA synthetase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 650

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/512 (44%), Positives = 326/512 (63%), Gaps = 9/512 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I YPN + HIGHAY  + AD +AR+ RL G DV F TGTDEHG KI + A+
Sbjct: 2   KPTFYVTTPIYYPNDKLHIGHAYTTVAADAIARYKRLRGYDVFFLTGTDEHGLKIQQRAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG+  K F+D      +D+   LDISYDDFIRTTE RH      +++++  +GDIY   
Sbjct: 62  QAGLEPKAFLDPIIAWIQDLWKKLDISYDDFIRTTEARHERVVEQIFERLLQQGDIYLSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+Y+ + E+  G   Q        VQ++ EE YFFR+S Y D+LL YYE +
Sbjct: 122 YQGWYCTPCESYWAERELVDGKCPQC----GREVQFVREESYFFRMSKYVDRLLQYYEEN 177

Query: 184 PEFILPIERRNEVI-SFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P FI P+ R+ E+I +F++ GL+DL +SR +FDWG+ +P +P++++YVW+DAL NY++  
Sbjct: 178 PGFIEPVSRKTEMIKNFIEPGLQDLCVSRTSFDWGVHVPSNPKHVVYVWLDALVNYISAI 237

Query: 243 GYLDNPDGSKAKF---WPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           GYL +    + KF   WPAD+HV+GKDI+RFHA+YWP  L++  LPLPKKVF HGF L K
Sbjct: 238 GYLSDDADERVKFERYWPADVHVVGKDIVRFHAVYWPIILMALGLPLPKKVFGHGFFLVK 297

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           G K+SKS GNVIDP+ +++  G DA RYFL+REI  G+DG +  +G+ +R+N DLAN  G
Sbjct: 298 GGKMSKSKGNVIDPLSLVDRYGRDAFRYFLLREIPFGQDGTFTPEGMVERLNYDLANDFG 357

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NLV R+ +M+ +  DG++P PG+ T+ D ++  + + V  ++ ENM       ALA++ +
Sbjct: 358 NLVHRTAAMLNRFNDGVVPAPGSLTDVDRALRDLAAEVKAKVEENMDQLQFSVALAELWN 417

Query: 420 LVSEVDRYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           LV   ++Y D  +PW+L K    +R +TVLY  VE IR  AIL+Q F+      I +   
Sbjct: 418 LVRAANKYIDDCQPWKLNKEGERERLATVLYHMVEAIRVSAILVQPFMTDAPKAIREQFG 477

Query: 479 VADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             DE   + S +  L P        +P+FPR 
Sbjct: 478 WGDEAFAWDSAEMGLGPSGQTVAEREPLFPRL 509


>gi|229107725|ref|ZP_04237362.1| Methionyl-tRNA synthetase [Bacillus cereus Rock1-15]
 gi|228675698|gb|EEL30905.1| Methionyl-tRNA synthetase [Bacillus cereus Rock1-15]
          Length = 660

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y + ++        K   G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVEPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|324324028|gb|ADY19288.1| methionyl-tRNA synthetase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 660

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLISRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E +  ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHTSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|222528338|ref|YP_002572220.1| methionyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
 gi|222455185|gb|ACM59447.1| methionyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
          Length = 653

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/517 (45%), Positives = 339/517 (65%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + HIGH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHIGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +D+  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQEYVDEIVASIKDLWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALVKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HP+FI+P  R NE+I+ F+K GL+D+ +SR T  WGI +P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPDFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGISVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSKFKKYWPADVHLVGKEIVRFHTIIWPAILMALGLPLPKMVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG + +D L+ R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGHFSEDSLRTRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I  P A  + D  ++++   V +++   +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGIIHLPEAKEDLDNELITLAKEVYEKVCRCLDELQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWEL--KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L   K+   R  TVLY   EV+R +AIL++ F+P+   KI   L +
Sbjct: 418 ARANKYIDETMPWVLGRDKSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILQQLGI 477

Query: 480 A-DEN---RCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           + DEN     ++S  Q  L P     K  DPIFPR +
Sbjct: 478 SKDENPDITTWESASQFSLIPEGTKVKRGDPIFPRIV 514


>gi|229027885|ref|ZP_04184040.1| Methionyl-tRNA synthetase [Bacillus cereus AH1271]
 gi|228733399|gb|EEL84226.1| Methionyl-tRNA synthetase [Bacillus cereus AH1271]
          Length = 660

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y      D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQR--LKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTVGCIPAGTKVEKG-QPIFPRL 523


>gi|229159212|ref|ZP_04287237.1| Methionyl-tRNA synthetase [Bacillus cereus R309803]
 gi|228624227|gb|EEK81028.1| Methionyl-tRNA synthetase [Bacillus cereus R309803]
          Length = 660

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 345/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++   +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVSGIKELWKKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y      D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAYKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDESDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSAIGCIPAGTKVEKG-QPIFPRL 523


>gi|229165027|ref|ZP_04292823.1| Methionyl-tRNA synthetase [Bacillus cereus AH621]
 gi|228618412|gb|EEK75441.1| Methionyl-tRNA synthetase [Bacillus cereus AH621]
          Length = 660

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/525 (44%), Positives = 347/525 (66%), Gaps = 17/525 (3%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           MKE  K  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI 
Sbjct: 1   MKEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           K A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDI
Sbjct: 61  KKAEELNVTPQAYVDNIVSGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI 120

Query: 120 YKGCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAY 172
           Y   Y GWYS++DE +Y      D + +G     G+  ++ H  V+ + EE YFFR+  Y
Sbjct: 121 YLDEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKY 179

Query: 173 QDKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVW 231
            D+LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW
Sbjct: 180 VDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVW 239

Query: 232 IDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVF 291
           +DAL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF
Sbjct: 240 VDALSNYITALGYGTENEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVF 299

Query: 292 SHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVN 351
           +HG+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N
Sbjct: 300 AHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERIN 359

Query: 352 ADLANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLI 410
            DLAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N   
Sbjct: 360 FDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEF 419

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPK 468
             AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+  
Sbjct: 420 SVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTV 479

Query: 469 LANKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             +K+F  L + +E ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 480 APSKMFAQLGLTEEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|300119133|ref|ZP_07056834.1| methionyl-tRNA synthetase [Bacillus cereus SJ1]
 gi|298723455|gb|EFI64196.1| methionyl-tRNA synthetase [Bacillus cereus SJ1]
          Length = 660

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  ++SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWESLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|163938046|ref|YP_001642930.1| methionyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
 gi|229009548|ref|ZP_04166775.1| Methionyl-tRNA synthetase [Bacillus mycoides DSM 2048]
 gi|229053885|ref|ZP_04195320.1| Methionyl-tRNA synthetase [Bacillus cereus AH603]
 gi|229131046|ref|ZP_04259959.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 gi|163860243|gb|ABY41302.1| methionyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
 gi|228652383|gb|EEL08307.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 gi|228721426|gb|EEL72946.1| Methionyl-tRNA synthetase [Bacillus cereus AH603]
 gi|228751692|gb|EEM01491.1| Methionyl-tRNA synthetase [Bacillus mycoides DSM 2048]
          Length = 660

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/525 (44%), Positives = 347/525 (66%), Gaps = 17/525 (3%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           MKE  K  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI 
Sbjct: 1   MKEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           K A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDI
Sbjct: 61  KKAEELNVTPQAYVDNIVSGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI 120

Query: 120 YKGCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAY 172
           Y   Y GWYS++DE +Y      D + +G     G+  ++ H  V+ + EE YFFR+  Y
Sbjct: 121 YLDEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKY 179

Query: 173 QDKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVW 231
            D+LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW
Sbjct: 180 VDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVW 239

Query: 232 IDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVF 291
           +DAL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF
Sbjct: 240 VDALSNYITALGYGTENEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVF 299

Query: 292 SHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVN 351
           +HG+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N
Sbjct: 300 AHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERIN 359

Query: 352 ADLANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLI 410
            DLAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N   
Sbjct: 360 FDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEF 419

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPK 468
             AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+  
Sbjct: 420 SVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTV 479

Query: 469 LANKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             +K+F  L + +E ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 480 APSKMFAQLGLTEEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|322382808|ref|ZP_08056652.1| methionyl-tRNA synthetase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153277|gb|EFX45723.1| methionyl-tRNA synthetase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 659

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/514 (43%), Positives = 343/514 (66%), Gaps = 13/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  Y++T I YP+ + HIGHAY  +  D LAR+ RL G DV++ TGTDEHGQKI + A+
Sbjct: 5   KKTFYLTTPIYYPSDKLHIGHAYTTVAGDALARYKRLRGYDVMYLTGTDEHGQKIERKAK 64

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T + FVD      +++   +DISYDDFIRTTE RH ++  +++ ++ ++GDIY G 
Sbjct: 65  EKGMTPQAFVDNIVAGIKELWGKMDISYDDFIRTTEDRHKESVSVIFARLMEQGDIYLGE 124

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E+++ ++++   ADG+  +    PV+ M+EE YFFR+S Y D+LL YYE +
Sbjct: 125 YEGWYCTSCESFFPENKL---ADGKCPDC-GGPVEKMKEESYFFRMSKYADRLLQYYEEN 180

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P+FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P+DP++++YVWIDAL+NY++  
Sbjct: 181 PDFIQPESRKNEMINNFIKPGLEDLAVSRATFDWGVKVPNDPKHVIYVWIDALSNYISAL 240

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY         K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF HG++L K  K
Sbjct: 241 GYGTKDSSKFDKYWPADVHLVGKEIIRFHTIYWPIMLMAMGLPLPKKVFGHGWLLMKDGK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+DP+ +I+  G+DALRYFL+RE+  G DG +  +   +R+N DLAN +GNL+
Sbjct: 301 MSKSKGNVVDPVTLIDRYGLDALRYFLLREVPFGADGQFTPESFVERINHDLANDLGNLL 360

Query: 363 SRSVSMILKDYDG--MIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           +R+V M++K +DG   +  PGA TE D  +L      + +  E M+N     AL+ + +L
Sbjct: 361 NRTVVMMMKYFDGKLQVYVPGA-TEYDADLLKTMEGSISKYEEAMENLEFSVALSALWTL 419

Query: 421 VSEVDRYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +   ++Y D  +PW L K+   +   +V+YV  E+ R ++ILLQ FV +   K++  L +
Sbjct: 420 IGRANKYIDETQPWVLAKEGKTETLGSVMYVLAEIQRIISILLQPFVTQTPAKMWSSLGI 479

Query: 480 AD-ENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            + E   + S+    +L  G  + KT DP+FPR 
Sbjct: 480 REGEMTTWDSIYTFGKLPAGTQVKKT-DPMFPRL 512


>gi|118475810|ref|YP_892961.1| methionyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
 gi|118415035|gb|ABK83454.1| methionyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
          Length = 669

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 12  EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 71

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 72  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 131

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 132 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 190

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 191 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 250

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 251 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 310

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 311 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 370

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 371 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 430

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 431 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 490

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  ++SL     +  G  + K   PIFPR 
Sbjct: 491 SKMFAQLGLTDEAHTSWESLSTIGCIPAGTKVEKG-QPIFPRL 532


>gi|229015441|ref|ZP_04172443.1| Methionyl-tRNA synthetase [Bacillus cereus AH1273]
 gi|229021646|ref|ZP_04178233.1| Methionyl-tRNA synthetase [Bacillus cereus AH1272]
 gi|228739649|gb|EEL90058.1| Methionyl-tRNA synthetase [Bacillus cereus AH1272]
 gi|228745860|gb|EEL95860.1| Methionyl-tRNA synthetase [Bacillus cereus AH1273]
          Length = 660

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVSGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y      D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    E++RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEILRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|229170889|ref|ZP_04298492.1| Methionyl-tRNA synthetase [Bacillus cereus MM3]
 gi|228612555|gb|EEK69774.1| Methionyl-tRNA synthetase [Bacillus cereus MM3]
          Length = 660

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 348/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGEKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKK+F+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKIFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRANKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|196041780|ref|ZP_03109070.1| methionine--tRNA ligase [Bacillus cereus NVH0597-99]
 gi|196027400|gb|EDX66017.1| methionine--tRNA ligase [Bacillus cereus NVH0597-99]
          Length = 660

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKIVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  ++SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWESLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|196047404|ref|ZP_03114617.1| methionyl-tRNA synthetase [Bacillus cereus 03BB108]
 gi|225862090|ref|YP_002747468.1| methionyl-tRNA synthetase [Bacillus cereus 03BB102]
 gi|229182433|ref|ZP_04309685.1| Methionyl-tRNA synthetase [Bacillus cereus BGSC 6E1]
 gi|196021806|gb|EDX60500.1| methionyl-tRNA synthetase [Bacillus cereus 03BB108]
 gi|225788827|gb|ACO29044.1| methionine--tRNA ligase [Bacillus cereus 03BB102]
 gi|228601013|gb|EEK58581.1| Methionyl-tRNA synthetase [Bacillus cereus BGSC 6E1]
          Length = 660

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  ++SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWESLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|196250752|ref|ZP_03149439.1| methionyl-tRNA synthetase [Geobacillus sp. G11MC16]
 gi|196209702|gb|EDY04474.1| methionyl-tRNA synthetase [Geobacillus sp. G11MC16]
          Length = 650

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/516 (43%), Positives = 337/516 (65%), Gaps = 14/516 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D LAR+ R+ G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++E+ YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEQSYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIIRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           ++R+V+MI K +DG+IP   G  T  DE ++     V+++  E M+      ALA V  L
Sbjct: 358 LNRTVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYEEAMERMEFSVALASVWQL 417

Query: 421 VSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +   ++Y D  +PW L K    R   ++V+    E +R  A+LLQ F+ +   +IF  L 
Sbjct: 418 IGRTNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTAVLLQPFLTRTPERIFAQLG 477

Query: 479 VADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           +AD  R  +  D   + G +   T     +P+FPR 
Sbjct: 478 IAD--RSLKEWDSLYEFGLIPEGTNVQKGEPLFPRL 511


>gi|206972593|ref|ZP_03233536.1| methionyl-tRNA synthetase [Bacillus cereus AH1134]
 gi|229176639|ref|ZP_04304044.1| Methionyl-tRNA synthetase [Bacillus cereus 172560W]
 gi|229188324|ref|ZP_04315373.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 10876]
 gi|206732495|gb|EDZ49674.1| methionyl-tRNA synthetase [Bacillus cereus AH1134]
 gi|228595123|gb|EEK52893.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 10876]
 gi|228606806|gb|EEK64222.1| Methionyl-tRNA synthetase [Bacillus cereus 172560W]
          Length = 660

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|138893709|ref|YP_001124162.1| methionine-tRNA ligase/methionyl-tRNA synthetase [Geobacillus
           thermodenitrificans NG80-2]
 gi|134265222|gb|ABO65417.1| Methionine-tRNA ligase/methionyl-tRNA synthetase [Geobacillus
           thermodenitrificans NG80-2]
          Length = 650

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/516 (43%), Positives = 337/516 (65%), Gaps = 14/516 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D LAR+ R+ G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++E+ YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDCGR-PVEKVKEQSYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIIRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           ++R+V+MI K +DG+IP   G  T  DE ++     V+++  E M+      ALA V  L
Sbjct: 358 LNRTVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYEEAMERMEFSVALASVWQL 417

Query: 421 VSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +   ++Y D  +PW L K    R   ++V+    E +R  A+LLQ F+ +   +IF  L 
Sbjct: 418 IGRTNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTAVLLQPFLTRTPERIFAQLG 477

Query: 479 VADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           +AD  R  +  D   + G +   T     +P+FPR 
Sbjct: 478 IAD--RSLKEWDSLYEFGLIPEGTNVQKGEPLFPRL 511


>gi|228905835|ref|ZP_04069733.1| Methionyl-tRNA synthetase [Bacillus thuringiensis IBL 200]
 gi|228853775|gb|EEM98534.1| Methionyl-tRNA synthetase [Bacillus thuringiensis IBL 200]
          Length = 660

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 347/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTNEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|134297944|ref|YP_001111440.1| methionyl-tRNA synthetase [Desulfotomaculum reducens MI-1]
 gi|134050644|gb|ABO48615.1| methionyl-tRNA synthetase [Desulfotomaculum reducens MI-1]
          Length = 518

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/510 (44%), Positives = 332/510 (65%), Gaps = 7/510 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           ++   YI+T I YP+   HIGHAY  + AD +AR+ RL G DV F TG+DEHGQKI +AA
Sbjct: 4   KKPNFYITTPIYYPSDNLHIGHAYTTVAADTMARYKRLTGYDVWFLTGSDEHGQKIERAA 63

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +N   T K +VD     F+ + + LD+SY+DFIRTT++RHH   +  ++++ D+GDIYK 
Sbjct: 64  KNKNQTPKEYVDHIVSGFKKLWERLDVSYNDFIRTTDERHHKVVQKFFQQLFDQGDIYKS 123

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E ++ +   Y+ A+G+  + Q   V+ + EE YFFR S Y ++ L + E 
Sbjct: 124 EYEGWYCTPCETFFTE---YQLAEGKCPDCQRE-VEKVREESYFFRQSKYAERWLKFIEE 179

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           +PEFI P+ RRNE++SFVK GL+DL +SR TFDWGI++P DP++++YVW+DALTNY++  
Sbjct: 180 NPEFIQPVSRRNEMVSFVKQGLEDLCVSRTTFDWGIRVPFDPKHVVYVWVDALTNYISAL 239

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY    +    KFWPAD+H++ KDI+RFHAI WP  L++ +LPLPKKV +HG++L    K
Sbjct: 240 GYDTGDNSLFQKFWPADIHLMAKDIVRFHAIIWPILLMALDLPLPKKVIAHGWLLLDSGK 299

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+DP  +I++ GVDA+RYFL+RE+  G DG Y ++ L KR+N DLAN  GNL+
Sbjct: 300 MSKSKGNVVDPHVLIDKYGVDAVRYFLLRELPFGSDGLYSEEALVKRINTDLANDYGNLL 359

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
           SRS +M+ K   G++ TPGA    DE ++ + +   + + E M+   +  ALA +  +V 
Sbjct: 360 SRSATMMEKYQQGVLQTPGAPEGPDEELIDLATATPKLVEEYMEKSELSNALAAIWQMVG 419

Query: 423 EVDRYFDAQKPWELKKTN-PDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
             ++Y +   PW L K N  +R +TVLY   EV+R   I++  F+P+L  +++  L + D
Sbjct: 420 RANKYLEETAPWTLAKNNETERLNTVLYNVAEVMRFATIMITPFMPQLPKRVWPQLGIED 479

Query: 482 ENR--CFQSLDQRLKPGFMLHKTFDPIFPR 509
           +     ++SL     P     K  + +FPR
Sbjct: 480 QTEIHTWESLRWGKLPVGTTVKRGEVLFPR 509


>gi|228937341|ref|ZP_04099988.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228970227|ref|ZP_04130887.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976797|ref|ZP_04137210.1| Methionyl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gi|228782893|gb|EEM31058.1| Methionyl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gi|228789462|gb|EEM37381.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228822299|gb|EEM68280.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326937830|gb|AEA13726.1| methionyl-tRNA synthetase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 660

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRIVAMIDKYFNGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|217957614|ref|YP_002336156.1| methionyl-tRNA synthetase [Bacillus cereus AH187]
 gi|229136885|ref|ZP_04265513.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST26]
 gi|217064186|gb|ACJ78436.1| methionyl-tRNA synthetase [Bacillus cereus AH187]
 gi|228646550|gb|EEL02756.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-ST26]
          Length = 660

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 343/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADENR-CFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE    + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHISWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|229083353|ref|ZP_04215709.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-44]
 gi|228699960|gb|EEL52589.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-44]
          Length = 660

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/525 (43%), Positives = 345/525 (65%), Gaps = 20/525 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E++  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI K 
Sbjct: 3   EEKKTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH +    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H  V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGH-AVELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLQFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  + +    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTDNEEKYKKYWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG IP      TE D+++++    +L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFDGEIPAFKENVTEFDQTLVAFAQDILKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDR---ASTVLYVTVEVIRQLAILLQAFVPKL 469
           AL+ +  LVS  ++Y D  +PW L K   DR   AS + ++  E++RQ  I+L  F+   
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDRDKLASAMAHLA-EMLRQTGIMLMPFLTAT 480

Query: 470 ANKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
            +KIF  L + DE   + S D     G +   T      PIFPR 
Sbjct: 481 PSKIFTQLGLTDE--AYHSWDSLSTIGCIPAGTKVVKGQPIFPRL 523


>gi|229067803|ref|ZP_04201121.1| Methionyl-tRNA synthetase [Bacillus cereus F65185]
 gi|228715287|gb|EEL67145.1| Methionyl-tRNA synthetase [Bacillus cereus F65185]
          Length = 660

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLIDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|228912778|ref|ZP_04076426.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228846838|gb|EEM91842.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 660

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 344/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y + ++        K   G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMVGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|49477589|ref|YP_034392.1| methionyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|196036355|ref|ZP_03103752.1| methionyl-tRNA synthetase [Bacillus cereus W]
 gi|218901239|ref|YP_002449073.1| methionyl-tRNA synthetase [Bacillus cereus AH820]
 gi|228925292|ref|ZP_04088389.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931541|ref|ZP_04094448.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943845|ref|ZP_04106231.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229119701|ref|ZP_04248963.1| Methionyl-tRNA synthetase [Bacillus cereus 95/8201]
 gi|301051774|ref|YP_003789985.1| methionine--tRNA ligase [Bacillus anthracis CI]
 gi|49329145|gb|AAT59791.1| methionine--tRNA ligase (methionyl-tRNA synthetase) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|195990985|gb|EDX54956.1| methionyl-tRNA synthetase [Bacillus cereus W]
 gi|218535747|gb|ACK88145.1| methionyl-tRNA synthetase [Bacillus cereus AH820]
 gi|228663726|gb|EEL19304.1| Methionyl-tRNA synthetase [Bacillus cereus 95/8201]
 gi|228815802|gb|EEM62037.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828093|gb|EEM73820.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834339|gb|EEM79879.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|300373943|gb|ADK02847.1| methionine--tRNA ligase [Bacillus cereus biovar anthracis str. CI]
          Length = 660

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 345/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|52145179|ref|YP_081651.1| methionyl-tRNA synthetase [Bacillus cereus E33L]
 gi|51978648|gb|AAU20198.1| methionine--tRNA ligase (methionyl-tRNA synthetase) [Bacillus
           cereus E33L]
          Length = 660

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 345/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|30018309|ref|NP_829940.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gi|229125556|ref|ZP_04254589.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
 gi|38258299|sp|Q81JA8|SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1; AltName:
           Full=Methionine--tRNA ligase 1; Short=MetRS 1
 gi|29893849|gb|AAP07141.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gi|228657873|gb|EEL13678.1| Methionyl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
          Length = 660

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      +++ + ++ISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKELWEKMNISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K + G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFSGEIPAFKANVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|206977934|ref|ZP_03238821.1| methionyl-tRNA synthetase [Bacillus cereus H3081.97]
 gi|229194429|ref|ZP_04321233.1| Methionyl-tRNA synthetase [Bacillus cereus m1293]
 gi|206743840|gb|EDZ55260.1| methionyl-tRNA synthetase [Bacillus cereus H3081.97]
 gi|228589019|gb|EEK47033.1| Methionyl-tRNA synthetase [Bacillus cereus m1293]
          Length = 660

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 343/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADENR-CFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE    + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHISWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|229089170|ref|ZP_04220452.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-42]
 gi|228694133|gb|EEL47814.1| Methionyl-tRNA synthetase [Bacillus cereus Rock3-42]
          Length = 660

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 345/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|228950587|ref|ZP_04112722.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228809062|gb|EEM55546.1| Methionyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 660

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 345/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD      + + + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNITPQAYVDNIVAGIKGLWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP      TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVAFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE ++ ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|321313708|ref|YP_004205995.1| methionyl-tRNA synthetase [Bacillus subtilis BSn5]
 gi|320019982|gb|ADV94968.1| methionyl-tRNA synthetase [Bacillus subtilis BSn5]
          Length = 664

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/528 (42%), Positives = 341/528 (64%), Gaps = 26/528 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+ + + + +   L+IS DDFIRTTEKRH      +++K+ D GDIY 
Sbjct: 63  AEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   + +   G+    +     +PV+ ++EE YFFR+  Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P++P++++YVWID
Sbjct: 183 RLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NYLT  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  GA TE D+++ SV    ++   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKVMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D   PW L K     +   +V+Y   E +R  A+LLQ F+ K  
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTKTP 482

Query: 471 NKIFDILFVADEN-RCFQSL-------DQRLKPGFMLHKTFDPIFPRF 510
            K+F+ L + DE+ + + S+       D +++ G       DP+FPR 
Sbjct: 483 EKMFEQLGITDESLKAWDSITAFGQLKDTKVQKG-------DPLFPRL 523


>gi|294496909|ref|YP_003560609.1| methionyl-tRNA synthetase [Bacillus megaterium QM B1551]
 gi|294346846|gb|ADE67175.1| methionyl-tRNA synthetase [Bacillus megaterium QM B1551]
          Length = 660

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 341/518 (65%), Gaps = 16/518 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A+   
Sbjct: 8   FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQRKAEEKN 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           VT + +VD      +++ D +DISYDDFIRTTE RH +    ++ ++ ++GDIY   Y G
Sbjct: 68  VTPQQYVDDIVSGIKELWDKMDISYDDFIRTTEPRHKEIVEKIFARLLEQGDIYLDEYEG 127

Query: 127 WYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           WYS+ DE YY + ++        K   G+  ++ H PV+ + EE YFF++  Y D+LL++
Sbjct: 128 WYSVPDETYYTEHQLVDPIVENGKVVGGKSPDSGH-PVELVREESYFFKMGKYVDRLLAF 186

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWIDAL+NY
Sbjct: 187 YEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVIYVWIDALSNY 246

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T+ GY    D S  K+WPA++H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L 
Sbjct: 247 ITSLGYDTENDESYRKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLM 306

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +R+N DLAN +
Sbjct: 307 KDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEAFVERINFDLANDL 366

Query: 359 GNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNLV+R+V+MI K +DG+IPT  G  TE D  I+      + +  E M++     ALA +
Sbjct: 367 GNLVNRTVAMINKYFDGVIPTYEGNVTEFDALIVQAQKDTVNKYEEAMEDMEFSVALASI 426

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
              VS  ++Y D  +PW L K    RA  ++V+    E IR +A+LLQ F+ +   KIF 
Sbjct: 427 WQYVSRTNKYIDETQPWALAKDENKRAELASVMTHLAESIRHIAVLLQPFLTRTPEKIFA 486

Query: 476 ILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            + V ++  + ++S  +   LK G  + K  +P+FPR 
Sbjct: 487 QIGVKEDVLKTWESTTRFNMLKEGTKVEKG-EPMFPRL 523


>gi|42779117|ref|NP_976364.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 10987]
 gi|42735032|gb|AAS38972.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 10987]
          Length = 660

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 346/523 (66%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE +  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G +V + TGTDEHGQKI K 
Sbjct: 3   KENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE D ++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDGTLVTFAQDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLISRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + +E +  ++SL     +  G  + K  +PIFPR 
Sbjct: 482 SKMFAQLGLTEEAHTSWESLSTIGCIPAGTKVEKG-NPIFPRL 523


>gi|229917422|ref|YP_002886068.1| methionyl-tRNA synthetase [Exiguobacterium sp. AT1b]
 gi|229468851|gb|ACQ70623.1| methionyl-tRNA synthetase [Exiguobacterium sp. AT1b]
          Length = 653

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/510 (43%), Positives = 337/510 (66%), Gaps = 8/510 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I YP+A+ HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A+
Sbjct: 3   KPTFYITTPIYYPSAKLHIGHAYTTVAGDAIARYKRLKGFDVRYLTGTDEHGQKIQEKAK 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AGVT + FVD+     + + D L+ISYDD+IRTTE RH      +++ +   GDIY G 
Sbjct: 63  EAGVTPQAFVDEVVEEIKVLWDRLEISYDDYIRTTEDRHKKVVEHVFETLLKNGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWYS+ DE YY + ++    DG+  ++ H PV+ + EE YFFRLS Y D+L+ Y+ESH
Sbjct: 123 YEGWYSVPDETYYTESQL---VDGKSPDSGH-PVELVREECYFFRLSKYADRLIEYFESH 178

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P+FILP  R+ E+I+ F+K GL+DL++SR TFDWG+++P +P++++YVW+DALTNY+++ 
Sbjct: 179 PDFILPESRKTEMINNFLKPGLQDLAVSRTTFDWGVQVPSNPKHVVYVWVDALTNYISSL 238

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY  + D    ++WPAD+H++GK+I+RFH I WPA L++ +LPLPK+VF+HG++L K  K
Sbjct: 239 GYGTDNDELFNRYWPADVHLVGKEIVRFHTIIWPALLMALDLPLPKQVFAHGWLLMKDGK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+DPI +I+  G+D++RY+L+RE+  G DG +  +    R+N DLAN +GNL+
Sbjct: 299 MSKSKGNVVDPIPLIDRYGLDSVRYYLLREVPFGADGTFTPEAFVDRLNFDLANDLGNLL 358

Query: 363 SRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +R+++MI K +DG IP   G  T  D  +L+V     ++  E M++     AL  +  LV
Sbjct: 359 NRTIAMIKKYFDGNIPAYNGNVTAFDAELLNVVKETTRKTEEAMEHMEFSVALTNIWQLV 418

Query: 422 SEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D  +PW L K    R   ++V+     V+R +AI++Q F+ +   ++F  L +
Sbjct: 419 SRANKYIDETQPWVLVKEESKREELASVMTHLAGVLRHVAIMIQPFMTRAPKEMFRQLGL 478

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
             E+  +++LD        +     PIFPR
Sbjct: 479 EGEDMSWEALDTFADFSDAVVTDGTPIFPR 508


>gi|302870971|ref|YP_003839607.1| methionyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
 gi|302573830|gb|ADL41621.1| methionyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
          Length = 653

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 233/517 (45%), Positives = 337/517 (65%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + H+GH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHVGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +++  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQQYVDEIVASIKELWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALMKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HPEFI+P  R NE+I+ F+K GL+D+ +SR T  WGI++P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPEFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGIEVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSRFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKTVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG++ +D LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGYFSEDALKNRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I  P    E D  +  +   V + + + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGVIYHPEEEEEIDNELKRLAKEVYENVCKLLDEFQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWELKKTNPD--RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K      R  TVLY   EV+R +A+L++ F+P+   KI   L +
Sbjct: 418 SRANKYIDQTMPWVLGKDKSKYPRLKTVLYNLAEVLRVVAVLIEPFMPQTTPKILQQLGI 477

Query: 480 A-DEN---RCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           + DEN     ++S  Q  L P     K  +PIFPR +
Sbjct: 478 SKDENLDITTWESASQYGLIPEGTKVKRGEPIFPRII 514


>gi|295702276|ref|YP_003595351.1| methionyl-tRNA synthetase [Bacillus megaterium DSM 319]
 gi|294799935|gb|ADF37001.1| methionyl-tRNA synthetase [Bacillus megaterium DSM 319]
          Length = 660

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 342/518 (66%), Gaps = 16/518 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A+   
Sbjct: 8   FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQRKAEEKN 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           VT + +VD      +++ D +DISYDDFIRTTE RH +    ++ ++ ++GDIY   Y G
Sbjct: 68  VTPQQYVDDIVSGIKELWDKMDISYDDFIRTTEPRHKEIVEKIFARLLEQGDIYLDEYEG 127

Query: 127 WYSLRDEAYYNDDEVY-------KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           WYS+ DE YY + ++        K   G+  ++ H PV+ + EE YFF++  Y D+LL++
Sbjct: 128 WYSVPDETYYTEHQLVDPIVENGKVVGGKSPDSGH-PVELVREESYFFKMGKYVDRLLAF 186

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWIDAL+NY
Sbjct: 187 YEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVIYVWIDALSNY 246

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T+ GY    D +  K+WPA++H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L 
Sbjct: 247 ITSLGYGTENDENYRKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLM 306

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +R+N DLAN +
Sbjct: 307 KDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEAFVERINFDLANDL 366

Query: 359 GNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNLV+R+V+MI K +DG+IPT  G  TE D  I+      + +  E M++     ALA +
Sbjct: 367 GNLVNRTVAMINKYFDGVIPTYEGNVTEFDALIVQAQKDTVNKYEEAMEDMEFSVALASI 426

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
              VS +++Y D  +PW L K    RA  ++V+    E IR +A+LLQ F+ +   KIF 
Sbjct: 427 WQYVSRMNKYIDETQPWALAKDENKRAELASVMTHLAESIRHIAVLLQPFLTRTPEKIFA 486

Query: 476 ILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            + V ++  + ++S  +   LK G  + K  +P+FPR 
Sbjct: 487 QIGVKEDVLKTWESTTRFNMLKEGTKVEKG-EPMFPRL 523


>gi|146295253|ref|YP_001179024.1| methionyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145408829|gb|ABP65833.1| methionyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 655

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 336/517 (64%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + HIGH Y  + AD LAR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHIGHTYCTVAADTLARYKRLQGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q  G T + +VD+   + +D+  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEVGKTPQKYVDEIVASIKDLWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALVKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HP+FI+P  R NE+I+ F+K GL+D+ +SR T  WGI +P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPDFIVPQSRANEMINNFIKPGLEDVCVSRTTLKWGIPVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKMVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG++ +D LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVVLAQKYGVDSLRYFLLREIPFGADGYFSEDALKTRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I  P    + D  ++++   V +++ + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGIIHLPEVKEDLDNELITLAKEVYEKVCKCLDELQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWEL--KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L   K+   R  TVLY   EV+R +AIL++ F+P+   K+   L +
Sbjct: 418 ARANKYIDETMPWVLGRDKSKHPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKMLAQLGI 477

Query: 480 A-DENRCFQSLDQRLKPGFMLHKTF----DPIFPRFL 511
           + DEN    S +     G +   T      P+FPR +
Sbjct: 478 SKDENPDITSWESAATFGLIRDGTKVKRDQPLFPRIV 514


>gi|312623342|ref|YP_004024955.1| methionyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312203809|gb|ADQ47136.1| methionyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 653

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/517 (45%), Positives = 338/517 (65%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + HIGH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHIGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +D+  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQEYVDEIVASIKDLWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALVKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HP+FI+P  R NE+I+ F+K GL+D+ +SR T  WGI +P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPDFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGIPVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKMVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG + +D L+ R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGHFSEDALRTRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +D +I  P A  + D  ++++   V +++   +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDEIIHLPEAKEDLDNELITLAKEVYEKVCRCLDELQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWEL--KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L   K+   R  TVLY   EV+R +AIL++ F+P+   KI   L +
Sbjct: 418 ARANKYIDETMPWVLGRDKSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILQQLGI 477

Query: 480 A-DEN---RCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           + DEN     ++S  Q  L P     K  DPIFPR +
Sbjct: 478 SKDENPDITAWESASQFGLIPEGTKVKRGDPIFPRIV 514


>gi|16077106|ref|NP_387919.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307847|ref|ZP_03589694.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312169|ref|ZP_03593974.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317102|ref|ZP_03598396.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321365|ref|ZP_03602659.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|586060|sp|P37465|SYM_BACSU RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|467427|dbj|BAA05273.1| methionyl-tRNA synthetase [Bacillus subtilis]
 gi|2632305|emb|CAB11814.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 664

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/528 (42%), Positives = 340/528 (64%), Gaps = 26/528 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+ + + + +   L+IS DDFIRTTEKRH      +++K+ D GDIY 
Sbjct: 63  AEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   + +   G+    +     +PV+ ++EE YFFR+  Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P++P++++YVWID
Sbjct: 183 RLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NYLT  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  GA TE D ++ SV    ++   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHTLTSVAEETVKAYEKAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D   PW L K     +   +V+Y   E +R  A+LLQ F+ K  
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTKTP 482

Query: 471 NKIFDILFVADEN-RCFQSL-------DQRLKPGFMLHKTFDPIFPRF 510
            K+F+ L + DE+ + + S+       D +++ G       +P+FPR 
Sbjct: 483 EKMFEQLGITDESLKAWDSITAFGQLKDTKVQKG-------EPLFPRL 523


>gi|296329539|ref|ZP_06872025.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672736|ref|YP_003864407.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296153282|gb|EFG94145.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305410979|gb|ADM36097.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 664

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/528 (42%), Positives = 340/528 (64%), Gaps = 26/528 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+ + + + +   L+IS DDFIRTTEKRH      +++K+ D GDIY 
Sbjct: 63  AEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   + +   G+    +     +PV+ ++EE YFFR+  Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P++P++++YVWID
Sbjct: 183 RLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NYLT  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  GA TE D+++ SV    ++   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D   PW L K     +   +V+Y   E +R  A+LLQ F+ K  
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELHSVMYHLAESLRISAVLLQPFLTKTP 482

Query: 471 NKIFDILFVADEN-RCFQSL-------DQRLKPGFMLHKTFDPIFPRF 510
            K+F+ L + DE  + + S+       D +++ G       +P+FPR 
Sbjct: 483 EKMFEQLGITDEALKAWDSITTFGQLKDTKVQKG-------EPLFPRL 523


>gi|313635219|gb|EFS01522.1| methionyl-tRNA synthetase [Listeria seeligeri FSL N1-067]
          Length = 665

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/522 (43%), Positives = 342/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  T   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKLTVEKIFEQLLEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK  +G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPSNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK +F HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMIFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    R+N DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFIDRMNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +   IP   GA T  DE+++   + V+ +  ++M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFXXXIPAYQGAVTPFDETLVDFKNNVVADYEKSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SLVS  ++Y D   PW L K    R   ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLVSRTNKYIDETAPWALAKDEEKRTELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTNVVKKGTPIFPRL 525


>gi|194017985|ref|ZP_03056592.1| methionyl-tRNA synthetase [Bacillus pumilus ATCC 7061]
 gi|194010322|gb|EDW19897.1| methionyl-tRNA synthetase [Bacillus pumilus ATCC 7061]
          Length = 666

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/525 (43%), Positives = 340/525 (64%), Gaps = 17/525 (3%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           M E++K  Y++T I YP+ + HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI 
Sbjct: 1   MPEKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           + A+   +T   ++D    + + +   LDIS DDFIRTTEKRH      +++K+ D+GDI
Sbjct: 61  QKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHTKIIEQVFQKLLDQGDI 120

Query: 120 YKGCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAY 172
           Y   Y GWYS+ DE +Y + +   V +   G+    +     +PV+ ++EE YFFR+S Y
Sbjct: 121 YLDQYEGWYSIPDETFYTETQLVDVERNEKGEVTGGKSPDSGHPVELIKEESYFFRMSKY 180

Query: 173 QDKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVW 231
            D+LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P++P++++YVW
Sbjct: 181 ADRLLDYYEKNPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPNNPKHVIYVW 240

Query: 232 IDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVF 291
           IDAL NYLT  GY  + D    K+WPA++H++GK+I+RFH IYWP  L++ +LPLPK++F
Sbjct: 241 IDALFNYLTAIGYGTDQDEKYKKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKQIF 300

Query: 292 SHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVN 351
           +HG++L K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +RVN
Sbjct: 301 AHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVN 360

Query: 352 ADLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLI 410
            DLAN +GNL++R+V+M+ K +DG + +  G   E DE + +V  + ++   E M+N   
Sbjct: 361 YDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLEF 420

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPK 468
             AL+ V +L+S  ++Y D   PW L K    R    +V+Y   E +R  A+LL  F+ K
Sbjct: 421 SVALSNVWTLISRTNKYIDQTAPWVLAKDETKRKELHSVMYHLAESLRITAVLLTPFLTK 480

Query: 469 LANKIFDILFVADENRCFQSLDQRLKPGFMLHKTF---DPIFPRF 510
              KIF  L + +E    +S D  L  G +   T    +P+FPR 
Sbjct: 481 TPEKIFFQLGIEEEK--LKSWDSILSFGAIQQATVQKGEPLFPRL 523


>gi|78044237|ref|YP_361414.1| methionyl-tRNA synthetase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996352|gb|ABB15251.1| methionyl-tRNA synthetase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 653

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/510 (44%), Positives = 333/510 (65%), Gaps = 9/510 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+T I YP+   HIGHAY  + AD +ARF R+ G DV F TG+DEHGQKI + A++
Sbjct: 3   KSFYITTPIYYPSDNLHIGHAYTTVAADTMARFKRMTGYDVWFLTGSDEHGQKIERKAKS 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G++ K +VD    +F+ +  +LDISYDDFIRTTE+RH    + +++K+ D+GDIYK  Y
Sbjct: 63  QGLSPKEYVDPIVDSFKHLWKLLDISYDDFIRTTEERHKKVVQAIFQKLYDQGDIYKSAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY    EA++ + ++    DG+  +    PV+W  EE YFF++S Y D+LL + E +P
Sbjct: 123 EGWYCTPCEAFWTEGKL---IDGKCPDCGR-PVEWTREESYFFKMSKYADRLLKHIEENP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           EFI+P  RRNE+I+F+K GL+DL +SR TF+WGI +P D ++++YVW+DALTNY++  GY
Sbjct: 179 EFIVPESRRNEMINFIKQGLEDLCVSRTTFNWGIPVPFDKKHVVYVWVDALTNYISALGY 238

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
             + D    K+WPAD+H++GKDI+RFH + WP  LL+  + LPKKV  HG+ + +G K+S
Sbjct: 239 GTDDDHLFQKYWPADVHLVGKDIVRFHTVIWPIILLALGIELPKKVVGHGWFVLEGGKMS 298

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS GNV+DP++++E+ GVDA+RYFLVRE+  G D  Y ++ L  R+N DLAN +GNL++R
Sbjct: 299 KSKGNVVDPVKLVEKYGVDAVRYFLVREMPLGLDAVYSEEALINRINVDLANDLGNLLNR 358

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++SM+ K   G IP P  + E D  ++ +   +  E  + M    +  ALA +  LV+ +
Sbjct: 359 TLSMLEKFLGGEIPLPSEYEEIDREVIELALALPAETEKLMDKFDLAGALANIWRLVTRL 418

Query: 425 DRYFDAQKPWELKKTNP-DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           ++Y D   PW L K    +R  TVLYV +E  R + +LL+  +P    K+   L V DE+
Sbjct: 419 NKYIDEVAPWSLNKEGKIERLKTVLYVVLEGYRFITVLLKPVMPNFPAKVSAQLGVNDES 478

Query: 484 R-CFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
              ++SL    RL  G  + K  +P+FPR 
Sbjct: 479 LFTWESLSNWGRLPAGVKIKKG-EPLFPRL 507


>gi|291482409|dbj|BAI83484.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. natto BEST195]
          Length = 664

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/528 (42%), Positives = 341/528 (64%), Gaps = 26/528 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+ + + + +   L+IS DDFIRTTEKRH      +++K+ D GDIY 
Sbjct: 63  AEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   + +   G+    +     +PV+ ++EE YFFR+  Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P++P++++YVWID
Sbjct: 183 RLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NYLT  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  GA TE D+++ SV    ++   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D   PW L K     +   +V+Y   E +R  A+LLQ F+ K  
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTKTP 482

Query: 471 NKIFDILFVADEN-RCFQSL-------DQRLKPGFMLHKTFDPIFPRF 510
            K+F+ L + D++ + + S+       D +++ G       +P+FPR 
Sbjct: 483 EKMFEQLGITDDSLKAWDSITAFGQLKDTKVQKG-------EPLFPRL 523


>gi|312134269|ref|YP_004001607.1| methionyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
 gi|311774320|gb|ADQ03807.1| methionyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
          Length = 653

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/517 (44%), Positives = 338/517 (65%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + H+GH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHVGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +++  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQEYVDEIVASIKELWKLMNISYDDFIRTTEERHKKVVQKIFSKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALMKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HPEFI+P  R NE+I+ F+K GL+D+ +SR T  WGI++P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPEFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGIEVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSRFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKTVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG++ ++ LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGYFSEEALKNRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I  P    E D  + S+   V + + + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGVIYLPEEKEEIDNELSSLAKEVYENVCKLLDEFQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWELKKTNPD--RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K +    R  TVLY   EV+R +AIL++ F+P+   KI   L +
Sbjct: 418 SRANKYIDQTMPWVLGKDSSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILQQLGI 477

Query: 480 A-DEN---RCFQSLDQ-RLKPGFMLHKTFDPIFPRFL 511
           + DEN     ++S  Q  L P     K  + +FPR +
Sbjct: 478 SKDENLDITTWESASQFGLIPEGTKVKRGEHVFPRII 514


>gi|312792522|ref|YP_004025445.1| methionyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312179662|gb|ADQ39832.1| methionyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 653

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 337/517 (65%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + H+GH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHVGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +++  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQQYVDEIVASIKELWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---IDGKCPDCGR-PVERAREESYFFRLSKYQDALMKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HPEFI+P  R NE+I+ F+K GL+D+ +SR T  WGI++P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPEFIVPQSRANEMINNFIKPGLEDICVSRTTIKWGIEVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSRFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKTVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG++ ++ LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVVLAQKYGVDSLRYFLLREIPFGADGYFSEEALKNRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I  P    E D  +  +   V + + + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGVIYLPEEKEEIDNELKDLAKEVYENVCKLLDEFQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWELKKTNPD--RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K      R  TVLY   EV+R +AIL++ F+P+   KI + L +
Sbjct: 418 SRANKYIDQTMPWVLGKDKSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILEQLGI 477

Query: 480 A-DENRCFQSLDQRLKPGFMLHKT----FDPIFPRFL 511
           + D+N    + +   + G +   T     +PIFPR +
Sbjct: 478 SKDKNPEITAWETAGQFGLIPEGTKVKRGEPIFPRIV 514


>gi|312877507|ref|ZP_07737468.1| methionyl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795710|gb|EFR12078.1| methionyl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 653

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 336/517 (64%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + H+GH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSDKLHVGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG T + +VD+   + +++  +++ISYDDFIRTTE+RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEAGKTPQQYVDEIVASIKELWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---IDGKCPDCGR-PVERAREESYFFRLSKYQDALMKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HPEFI+P  R NE+I+ F+K GL+D+ +SR T  WGI++P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPEFIVPQSRANEMINNFIKPGLEDICVSRTTIKWGIEVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L+S  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSRFKKYWPADVHLVGKEIVRFHTIIWPAMLMSLGLPLPKTVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG++ ++ LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVVLAQKYGVDSLRYFLLREIPFGADGYFSEEALKNRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +D +I  P    E D  +  +   V + + + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDSVIYLPEEKEEIDNELKDIAKEVYENVCKLLDEFQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWELKKTNPD--RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K      R  TVLY   EV+R +AIL++ F+P+   KI + L +
Sbjct: 418 SRANKYIDQTMPWVLGKDKSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILEQLGI 477

Query: 480 A-DENRCFQSLDQRLKPGFMLHKT----FDPIFPRFL 511
           + D+N    + +   + G +   T     +PIFPR +
Sbjct: 478 SKDKNPEITAWETAGQFGLIPEGTKVKRGEPIFPRIV 514


>gi|30260228|ref|NP_842605.1| methionyl-tRNA synthetase [Bacillus anthracis str. Ames]
 gi|47777767|ref|YP_016640.2| methionyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183072|ref|YP_026324.1| methionyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gi|65317498|ref|ZP_00390457.1| COG0143: Methionyl-tRNA synthetase [Bacillus anthracis str. A2012]
 gi|167635109|ref|ZP_02393426.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0442]
 gi|167641535|ref|ZP_02399783.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0193]
 gi|170688925|ref|ZP_02880127.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0465]
 gi|170707587|ref|ZP_02898040.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0389]
 gi|177655324|ref|ZP_02936853.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0174]
 gi|190569007|ref|ZP_03021908.1| methionyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I]
 gi|229600122|ref|YP_002864689.1| methionine--tRNA ligase [Bacillus anthracis str. A0248]
 gi|254682335|ref|ZP_05146196.1| methionyl-tRNA synthetase [Bacillus anthracis str. CNEVA-9066]
 gi|254724179|ref|ZP_05185964.1| methionyl-tRNA synthetase [Bacillus anthracis str. A1055]
 gi|254733574|ref|ZP_05191295.1| methionyl-tRNA synthetase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744658|ref|ZP_05202337.1| methionyl-tRNA synthetase [Bacillus anthracis str. Kruger B]
 gi|254762419|ref|ZP_05214261.1| methionyl-tRNA synthetase [Bacillus anthracis str. Australia 94]
 gi|38258301|sp|Q81W03|SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1; AltName:
           Full=Methionine--tRNA ligase 1; Short=MetRS 1
 gi|30253549|gb|AAP24091.1| methionine--tRNA ligase [Bacillus anthracis str. Ames]
 gi|47551472|gb|AAT29115.2| methionyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49176999|gb|AAT52375.1| methionyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gi|167510520|gb|EDR85918.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0193]
 gi|167529583|gb|EDR92333.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0442]
 gi|170127583|gb|EDS96457.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0389]
 gi|170667149|gb|EDT17910.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0465]
 gi|172080165|gb|EDT65258.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0174]
 gi|190559931|gb|EDV13915.1| methionyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I]
 gi|229264530|gb|ACQ46167.1| methionine--tRNA ligase [Bacillus anthracis str. A0248]
          Length = 660

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 344/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+  + G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DISYDDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|78223524|ref|YP_385271.1| methionyl-tRNA synthetase [Geobacter metallireducens GS-15]
 gi|78194779|gb|ABB32546.1| methionyl-tRNA synthetase [Geobacter metallireducens GS-15]
          Length = 509

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/505 (44%), Positives = 327/505 (64%), Gaps = 8/505 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  + ADVLAR+ RL G DV F TGTDEHGQK+ KAA  AG
Sbjct: 5   FYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGYDVFFLTGTDEHGQKVEKAANAAG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T     D+  + F+ + + LDISY+DFIRTT++RH      L++++  KGDIY G Y  
Sbjct: 65  ETPLELADRVVKRFQALWEKLDISYNDFIRTTQERHKKGVTHLFREVMAKGDIYLGEYED 124

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E ++ + ++    DG+  +  + PV+ ++EE YFFR+S YQ++LL++ E++P+F
Sbjct: 125 WYCTPCETFWTETQLI---DGKCPDC-NRPVEKLKEESYFFRMSKYQEQLLAHIEANPDF 180

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE+ISFVK GL+DLS+SR +F+WGI +P + ++++YVW DALTNY+T  GY D
Sbjct: 181 IQPKSRRNEIISFVKEGLRDLSVSRTSFNWGIPVPGNERHVIYVWFDALTNYITALGYPD 240

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
              G+  KFWP D H+IGKDILRFHA+YWP FL++A LP+P+KVF+HG+   +G+K+SKS
Sbjct: 241 QA-GNYGKFWPVDAHLIGKDILRFHAVYWPTFLMAAGLPVPRKVFAHGWWTVEGQKMSKS 299

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           L NV++P  ++++ G+DA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL+SRS 
Sbjct: 300 LQNVVEPNMLVDKYGIDAVRYFLLREVPFGLDGDFSHAALVHRINSDLANDLGNLLSRST 359

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +M+ K + G +P PGA TE D +  +    ++ ++   M      + L  +  ++S  ++
Sbjct: 360 AMVNKYFGGTLPQPGAMTELDAAFRARTEAMISQLESCMDEMAFSKGLQAIWEVISAGNK 419

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           Y D   PW L K     +R  T++Y  +E  R +  LL AF+P+ A K    L   +  R
Sbjct: 420 YIDESAPWTLAKDPAQKERLGTIMYTLLEAQRIVHTLLSAFMPRTAAKALGYLGCMEALR 479

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPR 509
                  +L PG  + K  + +FPR
Sbjct: 480 DEDLAWGKLVPGTQIAKA-EALFPR 503


>gi|157690820|ref|YP_001485282.1| methionyl-tRNA synthetase [Bacillus pumilus SAFR-032]
 gi|157679578|gb|ABV60722.1| methionine--tRNA ligase [Bacillus pumilus SAFR-032]
          Length = 666

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/526 (43%), Positives = 342/526 (65%), Gaps = 19/526 (3%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           M E++K  Y++T I YP+ + HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI 
Sbjct: 1   MPEKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           + A+   +T   ++D    + + +   LDIS DDFIRTTEKRH      +++K+ D+GDI
Sbjct: 61  QKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHTIIIGQVFQKLLDQGDI 120

Query: 120 YKGCYSGWYSLRDEAYYNDDEVY------KG--ADGQYYNAQHNPVQWMEEEGYFFRLSA 171
           Y   Y GWYS+ DE +Y + ++       KG    G+  ++ H PV+ ++EE YFFR+S 
Sbjct: 121 YLDQYEGWYSIPDETFYTETQLVDVEHNEKGEVTGGKSPDSGH-PVELIKEESYFFRMSK 179

Query: 172 YQDKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYV 230
           Y D+LL YYE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P++P++++YV
Sbjct: 180 YADRLLDYYEKNPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPNNPKHVIYV 239

Query: 231 WIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKV 290
           WIDAL NYLT  GY  + D    K+WPA++H++GK+I+RFH IYWP  L++ +LPLPK++
Sbjct: 240 WIDALFNYLTAIGYGTDQDEKYKKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKQI 299

Query: 291 FSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRV 350
           F+HG++L K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +RV
Sbjct: 300 FAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERV 359

Query: 351 NADLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQL 409
           N DLAN +GNL++R+V+M+ K +DG + +  G   E DE + +V  + ++   E M+N  
Sbjct: 360 NYDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLE 419

Query: 410 IHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVP 467
              AL+ V +L+S  ++Y D   PW L K    R    +V+Y   E +R  A+LL  F+ 
Sbjct: 420 FSVALSNVWTLISRTNKYIDQTAPWVLAKDESKRKELHSVMYHLAESLRITAVLLTPFLT 479

Query: 468 KLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTF---DPIFPRF 510
           K   KIF  L + +E    +S D  L  G +   T    +P+FPR 
Sbjct: 480 KTPEKIFFQLGIEEEK--LKSWDSILSFGAIQQATVQKGEPLFPRL 523


>gi|291278499|ref|YP_003495334.1| methionyl-tRNA synthetase [Deferribacter desulfuricans SSM1]
 gi|290753201|dbj|BAI79578.1| methionyl-tRNA synthetase [Deferribacter desulfuricans SSM1]
          Length = 640

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/514 (44%), Positives = 334/514 (64%), Gaps = 19/514 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  + ADVLAR+ RL G DV F TGTDEHGQKI +AAQ  G
Sbjct: 6   FYVTTPIYYVNDVPHIGHAYTTVAADVLARYKRLCGYDVFFLTGTDEHGQKIEQAAQKKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K   D     F+ +   L+IS D FIRTT++ H  T + ++KK+ + GDIY G Y G
Sbjct: 66  ITPKELADTVVERFKSLWVKLNISNDKFIRTTDEEHKKTVQKIFKKMQENGDIYLGEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E Y+ + ++    DG +  +       ++E  YFF++S YQ++LL Y + +P+F
Sbjct: 126 WYCTPCETYWTETQLL---DGNHCPSCGRETHKLKEPSYFFKMSKYQNELLKYIQENPDF 182

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  R+NE++SF+K GLKDLS+SR +F WGI +P D  +++YVWIDALTNY++  GYLD
Sbjct: 183 IQPTSRKNEIVSFIKEGLKDLSVSRVSFKWGIPVPGDENHVIYVWIDALTNYISAIGYLD 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                K K+WPAD+H++GKDILRFH +YWP  L+SA LPLPKKVF+HG+   +G+K+SKS
Sbjct: 243 ETKQFK-KYWPADVHLVGKDILRFHTVYWPTMLMSAGLPLPKKVFAHGWWTVEGQKMSKS 301

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           LGN IDP  +++  GVDA+RYFL+RE+  G DG +    L  R+N DLAN +GNL++R++
Sbjct: 302 LGNAIDPNWLVDTFGVDAIRYFLLREVPFGLDGDFSFKALIHRINGDLANDLGNLLNRTM 361

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
            M+ + ++G+IP      E+D+ +L+    V  E+  ++ N   ++AL  +  LVSE+++
Sbjct: 362 GMVKRYFNGIIPEYKVEDETDKELLAKIEEVFDEVDTHLNNIAFNKALISIWQLVSELNK 421

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI-----FDI-LF 478
           Y D   PW L K  +  DR  +VLY+ ++ IR L++L+  F+P+ + +I      DI +F
Sbjct: 422 YIDKNAPWMLAKDESKRDRLESVLYLVLDGIRILSLLIYPFMPQTSEEIRRQLNIDIDVF 481

Query: 479 VADENRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
            +D    F+ L   ++LKPG  L +    +FPR 
Sbjct: 482 KSD----FEDLKKVKQLKPGLKLGEA-KQLFPRI 510


>gi|319790219|ref|YP_004151852.1| methionyl-tRNA synthetase [Thermovibrio ammonificans HB-1]
 gi|317114721|gb|ADU97211.1| methionyl-tRNA synthetase [Thermovibrio ammonificans HB-1]
          Length = 526

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/475 (48%), Positives = 317/475 (66%), Gaps = 6/475 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           EK Y++T I Y N +PH+GHAY    ADV+ARF+R  G DV F TGTDEHGQKI +AA+ 
Sbjct: 3   EKFYVTTPIYYVNDKPHLGHAYTTTAADVVARFNRFLGRDVFFLTGTDEHGQKIQQAAEK 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G++ K FVD+    F+ + +VL+ISYD FIRTT+  H    + ++ K  + GDIY G Y
Sbjct: 63  MGMSPKEFVDRLVPVFKKLWEVLNISYDHFIRTTDPEHVKAVQHIFMKCYENGDIYLGEY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY +  E YY + ++    DG+   A    V  ++EE YFFRLS YQDKLL  YE +P
Sbjct: 123 EGWYCIPCETYYTEKDL---IDGKLCPACKREVTRVKEESYFFRLSKYQDKLLELYEKNP 179

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEVI+FVK GLKDLS+SR +F WGI +P + ++++YVW DALTNYLT  GY
Sbjct: 180 DFIGPEFRRNEVINFVKQGLKDLSISRTSFSWGIPVPINEKHVIYVWFDALTNYLTAVGY 239

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D+ +    ++WPADLH++GKDILRFHA+YWPAFL+SA LP+PK+VF+HG+   +GEK+S
Sbjct: 240 PDDTE-RLNRYWPADLHLVGKDILRFHAVYWPAFLMSAGLPVPKRVFAHGWWTVEGEKMS 298

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS GNV+DP EV+E+ GVD +R+FL RE++ G DG +  + L  R+N +LAN +GNL +R
Sbjct: 299 KSKGNVVDPFEVVEKFGVDQVRFFLFREVSFGLDGDFSYEKLVARINGELANDLGNLFNR 358

Query: 365 SVSMILKDYDGMIPTP-GAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           ++SM+ K    ++P P G F E D+ I +     L+ ++E +    + +AL ++   V  
Sbjct: 359 TLSMLKKYRKSVVPEPKGEFDELDKKIANKALATLKALKELIPRAELSKALDEIWQFVGF 418

Query: 424 VDRYFDAQKPWELKKTNPD-RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           V+ Y D + PW LKK   D    TVLY  VE +R +   L  ++P  A K+  +L
Sbjct: 419 VNYYIDRRAPWSLKKEGKDAELDTVLYNMVEALRFITAFLYPYMPASAEKMVQLL 473


>gi|297528406|ref|YP_003669681.1| methionyl-tRNA synthetase [Geobacillus sp. C56-T3]
 gi|297251658|gb|ADI25104.1| methionyl-tRNA synthetase [Geobacillus sp. C56-T3]
          Length = 650

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/514 (43%), Positives = 336/514 (65%), Gaps = 10/514 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D +AR+ R+ G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDCG-RPVEKVKEESYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI K +DG+IP   G  T  D+ +      V+++  E M+      ALA V  L
Sbjct: 358 LHRTVAMIEKYFDGVIPPYRGPKTPFDQELAQTAREVVRQYEEAMEGMEFSVALAAVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +S  ++Y D  +PW L K     D  + V+    E +R +A+LLQ F+ +   ++F  L 
Sbjct: 418 ISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHMAVLLQPFLTRTPERMFAQLG 477

Query: 479 VADEN-RCFQSL-DQRLKPGFMLHKTFDPIFPRF 510
           + D + + + SL D  L P     +  +P+FPR 
Sbjct: 478 ITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRL 511


>gi|297582380|ref|YP_003698160.1| methionyl-tRNA synthetase [Bacillus selenitireducens MLS10]
 gi|297140837|gb|ADH97594.1| methionyl-tRNA synthetase [Bacillus selenitireducens MLS10]
          Length = 662

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/522 (43%), Positives = 340/522 (65%), Gaps = 15/522 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+   YI+T I YP+A+ HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A
Sbjct: 4   EKNTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIEQKA 63

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  G + + FVD  S + +++   LDISYDDFIRTTE RH    + ++++  ++GDIY  
Sbjct: 64  EENGKSPQQFVDDISSDIQELWKKLDISYDDFIRTTEDRHKQVVQHIFERFLEQGDIYLD 123

Query: 123 CYSGWYSLRDEAYYND--------DEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
            Y GWYS+ DE +Y +        D+      G+  ++ H PV+ + E+ YFF++S Y D
Sbjct: 124 EYEGWYSVSDETFYTELQLEDKEYDDNGNVTGGKSPDSGH-PVEKVREKSYFFKMSKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL+YYE +PEFI P  R+NE+I+ F+K GL+DL++SR +F WG+ +  DP++++YVWID
Sbjct: 183 RLLAYYEDNPEFIQPESRKNEMINNFIKPGLEDLAVSRTSFRWGVPVKSDPEHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  + +G     WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF H
Sbjct: 243 ALSNYITALGYSTDENGLFQSHWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFGH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+DALRY+L+RE+  G DG +  +G  +RVN D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVPLIERYGLDALRYYLLREVPFGSDGVFTPEGFVERVNYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++RSV+MI K +DG +P      T  DE++  +    + ++ E+M+N     
Sbjct: 363 LANDLGNLLNRSVAMINKYFDGEVPAYVKDATSYDETLTDLVEATVNKVEESMENMQFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  L+S  ++Y D  +PW L K  T  ++  +VL+  VE +RQ++I+LQ F+ +  
Sbjct: 423 ALTAIGQLISRTNKYIDETQPWILAKDETAREQLGSVLHHLVESLRQVSIMLQPFMTETP 482

Query: 471 NKIFDILFVADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            KI + L + D    + +L    ++  G  +    +PIFPR 
Sbjct: 483 KKIQEQLSIPDSLMGWDTLVTFGQIPAGKKVVAKGEPIFPRL 524


>gi|312128513|ref|YP_003993387.1| methionyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
 gi|311778532|gb|ADQ08018.1| methionyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
          Length = 653

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/517 (44%), Positives = 335/517 (64%), Gaps = 12/517 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E+ K YI+T I YP+ + HIGH Y  + AD +AR+ RL G DV F TGTDEHGQKI + A
Sbjct: 2   EKPKFYITTPIYYPSEKLHIGHTYCTVAADTIARYKRLRGYDVFFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q  G T + +VD+   + +D+  +++ISYDDFIRTTE RH    + ++ K+ ++GDIYK 
Sbjct: 62  QEVGKTPQEYVDEIVASIKDLWKLMNISYDDFIRTTEDRHKKVVQKIFTKLYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++ D ++    DG+  +    PV+   EE YFFRLS YQD L+ Y E 
Sbjct: 122 EYEGWYCTPCESFWLDRQL---VDGKCPDCGR-PVERAREESYFFRLSKYQDALVKYIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           HP+FI+P  R NE+I+ F+K GL+D+ +SR T  WGI +P DP++++YVWIDAL+NY+T 
Sbjct: 178 HPDFIVPQSRANEMINNFIKPGLEDVCVSRTTIKWGIPVPFDPKHVIYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY+   D    K+WPAD+H++GK+I+RFH I WPA L++  LPLPK VF HG++L +G 
Sbjct: 238 LGYMSEDDSKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKMVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ + ++ GVD+LRYFL+REI  G DG + +D LK R N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVILAQKYGVDSLRYFLLREIPFGADGHFSEDALKTRHNSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +SR+V+MI K +DG+I       + D  ++++   V +++ + +       AL ++  L+
Sbjct: 358 LSRTVAMIEKYFDGIIHLTEEKEDLDNELITLAKEVYEKVCKCLDELQFSNALIEIWKLI 417

Query: 422 SEVDRYFDAQKPWEL--KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L   K+   R  TVLY   EV+R +AIL++ F+P+   KI   L +
Sbjct: 418 ARANKYIDETMPWVLGRDKSKYPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKILQQLGI 477

Query: 480 A-DENRCFQSLDQRLKPGFMLHKT----FDPIFPRFL 511
           + DEN    + +   + G +   T     +PIFPR +
Sbjct: 478 SKDENPDITAWESASQFGLIPEGTKVQRGEPIFPRIV 514


>gi|323701662|ref|ZP_08113334.1| methionyl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
 gi|323533435|gb|EGB23302.1| methionyl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
          Length = 514

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/509 (43%), Positives = 323/509 (63%), Gaps = 7/509 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I YP+ + HIGHAY  + AD +ARF RL G DV F TG+DEHGQKI +AA+
Sbjct: 3   KPTFYITTPIYYPSDKLHIGHAYTTVAADAMARFKRLTGYDVWFLTGSDEHGQKIERAAK 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
               T K +VD     F+ +   LD+SY+DFIRTT++RH    + +++++ D+GDIYK  
Sbjct: 63  AKNQTPKEYVDHIVDGFKKLWSRLDVSYNDFIRTTDERHRKVVQQIFQQLYDQGDIYKSE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E ++ +   Y+  +G+  + Q   V+ + EE YFFR S Y ++ L + E +
Sbjct: 123 YEGWYCTPCETFFTE---YQLVEGKCPDCQRE-VEKVREESYFFRQSKYAERWLKFIEEN 178

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P+ RRNE++SFVK GL+DL +SR TFDWGI +P DP++++YVW+DALTNY++  G
Sbjct: 179 PDFIQPVSRRNEMVSFVKQGLEDLCVSRTTFDWGIPVPFDPKHVVYVWVDALTNYISALG 238

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y    D    KFWPAD+H++GKDI+RFH I WP  L++ NLPLPKKV  HG++L    K+
Sbjct: 239 YGSEDDSLYRKFWPADIHLVGKDIVRFHTIIWPIMLMALNLPLPKKVIGHGWLLLDSGKM 298

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP  ++++ GVDA+RYFL+RE+  G DG Y ++ L KR+N DLAN  GNL+S
Sbjct: 299 SKSKGNVVDPHTLVDKYGVDAVRYFLLRELPFGSDGLYSEEALVKRINTDLANDYGNLLS 358

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS +M+ K  +G++  PG     D  ++ +     + + E M    I  ALA +  LV  
Sbjct: 359 RSATMVQKYQEGVLQAPGPAAGPDAELIDLAINTPKLVAEYMDKSEISNALAAIWQLVGR 418

Query: 424 VDRYFDAQKPWELKKT-NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD- 481
            ++Y +   PW L K   P+R +TVLY   EV+R + I+   F+P L  +++  L +AD 
Sbjct: 419 ANKYLEETAPWSLAKAGQPERLNTVLYNVAEVVRFVTIMASPFMPNLPQRVWPQLGIADK 478

Query: 482 -ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
            E   ++SL     P     +  + +FPR
Sbjct: 479 PELHTWESLRWGSLPAGTTVQRGEVLFPR 507


>gi|167629315|ref|YP_001679814.1| methionyl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
 gi|167592055|gb|ABZ83803.1| methionyl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
          Length = 668

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 327/520 (62%), Gaps = 11/520 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           + R   YI+T I YP+  PHIGHAY  +  D +AR+ RL G DV F TG DEHGQKI +A
Sbjct: 4   QPRPTFYITTPIYYPSGNPHIGHAYTTVATDTMARYKRLRGCDVWFLTGLDEHGQKIERA 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           AQ  G+    ++D  +  F+ + + L+I+YDDFIRTTE+RH    +++++KI DKGDIYK
Sbjct: 64  AQGKGMAPIDYLDPVAVTFKKLWERLEITYDDFIRTTEERHKKAVQVIFQKIWDKGDIYK 123

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y GWY    EA++ + ++  G  G+      + PV+ M+EE YFFR+S Y D+LL + 
Sbjct: 124 SEYEGWYCTPCEAFWPERQLKIGEKGEKLCPDCDRPVERMKEESYFFRMSKYADRLLQHI 183

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +PEFI P+ RRNE++SF+K GL+DL +SR TF WGI +P +  +++YVW DAL+NY+T
Sbjct: 184 EENPEFIQPVSRRNEMVSFIKQGLEDLCVSRTTFKWGIPVPINANHVIYVWFDALSNYIT 243

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY  + D    ++WPAD+H++GKDI+RFH I WP  L++   PLPK+VFSHG+ L + 
Sbjct: 244 ALGYGSDDDEKYRRYWPADIHLVGKDIVRFHTIIWPIILMALGEPLPKQVFSHGWFLLES 303

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS GNV+DP  + +  GVDA RYFL+RE+  G+D  + ++ L  R+N DLAN +GN
Sbjct: 304 GKMSKSKGNVVDPFMLADRYGVDAFRYFLIREMIGGQDALFSEETLISRINTDLANDLGN 363

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTES--DESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           L+ RS+SM+ +   G++  P A  E   ++ I  + ++ + +    M    +  A + + 
Sbjct: 364 LLHRSLSMVERFSGGIVRAPEAAAEGPLEKEIRELTAKTVADFGALMDRFELANAHSALW 423

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
            L+  +++Y D + PW L K    +A    VLY  VE +R  AILLQA +P +A KIF  
Sbjct: 424 KLIGRMNKYIDERAPWSLAKKPEAKAELEAVLYTMVESLRITAILLQAAMPNVAGKIFAQ 483

Query: 477 LFVADENR---CFQSLDQR---LKPGFMLHKTFDPIFPRF 510
           L ++ ENR   C  + D     L P  +     DPIFPR 
Sbjct: 484 LGLSGENRPASCLMTWDAARWGLFPDGVKVAKGDPIFPRI 523


>gi|328551739|gb|AEB22231.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens TA208]
 gi|328909999|gb|AEB61595.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens LL3]
          Length = 663

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 337/522 (64%), Gaps = 14/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+     + +   LDIS+DDFIRTTE RH +    +++K+ D GDIY 
Sbjct: 63  AEEENITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   V +   G+    +     +PV+ ++EE YFFR+S Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWID
Sbjct: 183 RLLKFYEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY+T  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYITALGYDTENDELYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  G  T+ D+ + SV    +Q   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMIQKYFDGEIGSYEGNVTDFDQELSSVAGETVQAYEKAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS---TVLYVTVEVIRQLAILLQAFVPKL 469
           AL+ +  L+S  ++Y D   PW L K +P++     +V+Y   E +R  A+LLQ F+ + 
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAK-DPEKEKELRSVMYHLAESLRISAVLLQPFLTQT 481

Query: 470 ANKIFDILFVADEN-RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             K+F  L V D++ + + S+    +      K  +P+FPR 
Sbjct: 482 PEKMFAQLGVEDQSLKAWDSIQTFGQLKSTKVKKGEPLFPRL 523


>gi|308171929|ref|YP_003918634.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens DSM 7]
 gi|307604793|emb|CBI41164.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens DSM 7]
          Length = 663

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 337/522 (64%), Gaps = 14/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E    YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+     + +   LDIS+DDFIRTTE RH +    +++K+ D GDIY 
Sbjct: 63  AEEENITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   V +   G+    +     +PV+ ++EE YFFR+S Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWID
Sbjct: 183 RLLKFYEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY+T  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYITALGYDTENDELYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG I +  G  T+ D+ + SV    +Q   + M+N     
Sbjct: 363 LANDLGNLLNRTVAMIQKYFDGEIGSYEGNVTDFDQELSSVAGETVQAYEKAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS---TVLYVTVEVIRQLAILLQAFVPKL 469
           AL+ +  L+S  ++Y D   PW L K +P++     +V+Y   E +R  A+LLQ F+ + 
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAK-DPEKEKELRSVMYHLAESLRISAVLLQPFLTQT 481

Query: 470 ANKIFDILFVADEN-RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
             K+F  L V D++ + + S+    +      K  +P+FPR 
Sbjct: 482 PEKMFAQLGVEDQSLKAWDSIQTFGQLKSTKVKKGEPLFPRL 523


>gi|56418566|ref|YP_145884.1| methionyl-tRNA synthetase [Geobacillus kaustophilus HTA426]
 gi|56378408|dbj|BAD74316.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Geobacillus
           kaustophilus HTA426]
          Length = 650

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/514 (43%), Positives = 336/514 (65%), Gaps = 10/514 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D +AR+ R+ G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEESYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIILMALGLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI K +DG+IP   G  T  D+ ++     V+++  E M+      ALA V  L
Sbjct: 358 LHRTVAMIEKYFDGVIPPYRGPKTPFDQELVQTAREVVRQYEEAMEGMEFSVALAAVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +S  ++Y D  +PW L K     D  + V+    E +R  A+LLQ F+ +   ++F  L 
Sbjct: 418 ISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTAVLLQPFLTRTPERMFAQLG 477

Query: 479 VADEN-RCFQSL-DQRLKPGFMLHKTFDPIFPRF 510
           + D + + + SL D  L P     +  +P+FPR 
Sbjct: 478 ITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRL 511


>gi|261417531|ref|YP_003251213.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|319765188|ref|YP_004130689.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC52]
 gi|261373988|gb|ACX76731.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|317110054|gb|ADU92546.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC52]
          Length = 650

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/514 (43%), Positives = 336/514 (65%), Gaps = 10/514 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D +AR+ R+ G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT + +VD+     +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  EEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDCG-RPVEKVKEESYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI + +DG+IP   G  T  D+ ++     V+++  E M+      ALA V  L
Sbjct: 358 LHRTVAMIERYFDGVIPPYRGPKTTFDQELVQTAREVVRQYEEAMEGMEFSVALAAVWQL 417

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +S  ++Y D  +PW L K     D  + V+    E +R  A+LLQ F+ +   ++F  L 
Sbjct: 418 ISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTAVLLQPFLTRTPERMFAQLG 477

Query: 479 VADEN-RCFQSL-DQRLKPGFMLHKTFDPIFPRF 510
           + D + + + SL D  L P     +  +P+FPR 
Sbjct: 478 ITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRL 511


>gi|165872552|ref|ZP_02217184.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0488]
 gi|227812711|ref|YP_002812720.1| methionyl-tRNA synthetase [Bacillus anthracis str. CDC 684]
 gi|254756363|ref|ZP_05208392.1| methionyl-tRNA synthetase [Bacillus anthracis str. Vollum]
 gi|164711680|gb|EDR17225.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0488]
 gi|227004168|gb|ACP13911.1| methionine--tRNA ligase [Bacillus anthracis str. CDC 684]
          Length = 660

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 343/523 (65%), Gaps = 16/523 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E +  YI+T I YP+ + HIGHAY  +  D +AR+  + G +V + TGTDEHGQKI K 
Sbjct: 3   EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQKK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   VT + +VD      +++ + +DIS DDFIRTTE RH D    ++K++ D+GDIY 
Sbjct: 63  AEELNVTPQAYVDNIVAGIKELWEKMDISCDDFIRTTEDRHKDVVEKIFKQLVDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQD 174
             Y GWYS++DE +Y +    D + +G     G+  ++ H+ V+ + EE YFFR+  Y D
Sbjct: 123 DEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD-VELVREESYFFRMGKYVD 181

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVW+D
Sbjct: 182 RLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVD 241

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY    +    KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 242 ALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAH 301

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 302 GWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFD 361

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K ++G IP   A  TE DE++++     L+++ E M+N     
Sbjct: 362 LANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSV 421

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  LVS  ++Y D  +PW L K   DR   ++V+    EV+RQ  I+L  F+    
Sbjct: 422 ALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAP 481

Query: 471 NKIFDILFVADE-NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +K+F  L + DE +  + SL     +  G  + K   PIFPR 
Sbjct: 482 SKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKG-QPIFPRL 523


>gi|311070685|ref|YP_003975608.1| methionyl-tRNA synthetase [Bacillus atrophaeus 1942]
 gi|310871202|gb|ADP34677.1| methionyl-tRNA synthetase [Bacillus atrophaeus 1942]
          Length = 664

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/524 (42%), Positives = 338/524 (64%), Gaps = 18/524 (3%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +++   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QDKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T + +VD+ + + + +   L+IS DDFIRTTE RH      +++K+ D GDIY 
Sbjct: 63  AEEENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTESRHKVVIEKVFQKLFDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   + +   G+    +     +PV+ ++EE YFFR+S Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDIERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL++YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWID
Sbjct: 183 RLLAFYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NYLT  G+    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+H
Sbjct: 243 ALFNYLTALGFDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG + +  G  TE D+++ SV    ++     M+N     
Sbjct: 363 LANDLGNLLNRTVAMINKYFDGNLGSYEGTITEFDQTLSSVAEETVKSYERAMENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +  L+S  ++Y D   PW L K         +V+Y   E +R  A+LLQ F+ K  
Sbjct: 423 ALSTLWQLISRTNKYIDETAPWVLAKDPAKEKELQSVMYHLAESLRISAVLLQPFLTKTP 482

Query: 471 NKIFDILFVADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
            K+F+ L + DE    ++ D   + G  L+KT     DP+FPR 
Sbjct: 483 KKMFEQLGITDE--TLKAWDSITRFG-QLNKTKVQKGDPLFPRL 523


>gi|288554646|ref|YP_003426581.1| methionyl-tRNA synthetase [Bacillus pseudofirmus OF4]
 gi|288545806|gb|ADC49689.1| methionyl-tRNA synthetase [Bacillus pseudofirmus OF4]
          Length = 666

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/524 (42%), Positives = 342/524 (65%), Gaps = 16/524 (3%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E +  Y++T I YP+A+ HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI +
Sbjct: 1   MSENKTFYLTTPIYYPSAKLHIGHAYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIEQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A   G+T + FVD+   + + +   LDISYDDFIRTTE RH    + +++++ ++GDIY
Sbjct: 61  KAAEKGLTPQQFVDEIVADIQSLWKKLDISYDDFIRTTEDRHKKVVQTIFERLLEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYND--------DEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAY 172
              Y GWYS+ DE +Y +        DE  K   G+  ++ H PV+ + E+ YFF++S Y
Sbjct: 121 LDEYEGWYSIPDETFYTELQLVDPIRDEDGKIIGGKSPDSGH-PVEKVREQSYFFKMSKY 179

Query: 173 QDKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVW 231
            D+LL +YE +P FI P  RRNE+I+ F+K GL+DL++SR +F WG+++P +P++++YVW
Sbjct: 180 ADRLLKFYEENPTFIQPESRRNEMINNFIKPGLEDLAVSRTSFKWGVQVPSNPEHVVYVW 239

Query: 232 IDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVF 291
           IDAL+NY+T  GY  + D    K+WPA++H++GK+I+RFH IYWP  L++ +LPLPKKVF
Sbjct: 240 IDALSNYITALGYGQDNDEFYQKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVF 299

Query: 292 SHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVN 351
           +HG++L K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +G  +RVN
Sbjct: 300 AHGWLLMKDGKMSKSKGNVVDPETLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERVN 359

Query: 352 ADLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLI 410
            DLAN +GNL++R+V+MI K +DG IPT     T  D  +L + +  + ++   M+    
Sbjct: 360 YDLANDLGNLLNRTVAMINKYFDGSIPTYVKDATPFDADLLDLVNATVTKVENAMEEMEF 419

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPK 468
             AL  +  LVS  ++Y D  +PW L K  +  +   +V+Y   E +R +++L+Q F+ +
Sbjct: 420 SVALTAIWQLVSRTNKYIDETQPWMLAKDDSKKEELGSVMYHLAESLRYISVLIQPFLTE 479

Query: 469 LANKIFDILFVADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
              K+++ L + +E   ++SL +  ++  G  + K   PIFPR 
Sbjct: 480 TPKKVWEQLGLGEEVTTWESLSEFAQIPAGVTVQKG-KPIFPRL 522


>gi|217077634|ref|YP_002335352.1| methionyl-tRNA synthetase [Thermosipho africanus TCF52B]
 gi|217037489|gb|ACJ76011.1| methionyl-tRNA synthetase [Thermosipho africanus TCF52B]
          Length = 638

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/504 (43%), Positives = 333/504 (66%), Gaps = 15/504 (2%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +K YI+T I Y N++PHIG AY  II D++AR+ RL G +V + TGTDEHGQKI +AA+ 
Sbjct: 2   KKFYITTPIYYVNSEPHIGSAYTTIIGDIIARYKRLMGYEVFYLTGTDEHGQKIMQAAKK 61

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G T +   D+ S+ F  +   L I+ D FIRTT++ H  T +    K+ +  DIYKG Y
Sbjct: 62  QGKTPQQLCDELSKKFEQLWKDLKITNDYFIRTTDEEHIKTVQFFVSKMLENEDIYKGKY 121

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQ-YYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
            GWY +  E Y+++DE+ K  +      + H P+ ++EEE YFFRLS Y + LL +++ +
Sbjct: 122 KGWYCVPCETYWSEDEIEKDENNNPVCPSCHRPLNFVEEENYFFRLSKYTEPLLKHFKEN 181

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+F+ P  R+NE++  ++ GLKDLS++R TFDWGI +P+DP++++YVW+DAL NY++  G
Sbjct: 182 PDFVEPEFRKNEMLKILEEGLKDLSITRTTFDWGIPMPNDPKHVIYVWVDALINYISAIG 241

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + +  K K+WPADLH+IGK+I RFH++ WPA L+S  LPLPKK+F+HG++   G+KI
Sbjct: 242 YGKDEETFK-KWWPADLHLIGKEINRFHSLIWPAMLMSVGLPLPKKIFAHGWLTVNGQKI 300

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDP E +++ G D +RY+L R+I  GKDG + ++ L  R+N+DLAN  GNL+ 
Sbjct: 301 SKSLGNAIDPREFVKKYGNDVIRYYLARDIVFGKDGDFSEENLVNRLNSDLANDYGNLLH 360

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++M++K++D  IPTP +  ESD+ ++     + +E  E M++  +  AL  + S + +
Sbjct: 361 RTLAMVVKNFDSKIPTPSSLNESDKELIEKFKNLKKEYTEYMESYKLTNALESIWSYIRD 420

Query: 424 VDRYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           V++YFD  KPW L K+ N +R  T+LY T+E   ++A LL  F+P  + ++         
Sbjct: 421 VNKYFDENKPWVLAKEGNKERLGTILYNTLEAFIKIASLLLPFMPDSSKEV--------- 471

Query: 483 NRCFQSLDQRLKPGFMLHKTFDPI 506
              F+ L Q   P F+L+  ++ +
Sbjct: 472 ---FRRLGQEFNPEFVLNTEWNSL 492


>gi|255659102|ref|ZP_05404511.1| methionine--tRNA ligase [Mitsuokella multacida DSM 20544]
 gi|260848546|gb|EEX68553.1| methionine--tRNA ligase [Mitsuokella multacida DSM 20544]
          Length = 650

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 322/479 (67%), Gaps = 6/479 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E++  YI+T I YP+A+ HIGHAY   IAD +ARFHRL G DV F TG+DEHGQKI +
Sbjct: 1   MTEKKPFYITTPIYYPSAKLHIGHAYCTTIADSIARFHRLIGDDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+ AGVT   +VD+    F+++   L IS DDFIRTT+KRH    + ++ +I  KGDIY
Sbjct: 61  KAEEAGVTPIEYVDKIVAGFQNLWKRLHISNDDFIRTTQKRHERVVQEIFNRIYAKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+ + ++    +G   +  H PVQ + EE YFF++S Y D++L Y 
Sbjct: 121 KGAYKGLYCTPCESYWTEHQL--DENGCCPDC-HRPVQEVSEEAYFFKMSKYADRVLQYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E HP+FI P+ RRNE+I+F+K GL DL +SR +F+WGI +P DP++++YVW DALTNYLT
Sbjct: 178 EDHPDFIQPVSRRNEMINFIKQGLDDLCISRTSFNWGIPVPIDPKHVIYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             G+LD P+    K+WPADLH++GK+I+RFH I WP  L++ +LPLPKKV+ HG+++  G
Sbjct: 238 PIGFLDAPEKFH-KYWPADLHLVGKEIVRFHTIIWPCILMALDLPLPKKVYGHGWLIVDG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           +K+SKS GNV+DP  +I+E G DA+RYFL+REI  G+DG + +D L +R+N+DLAN +GN
Sbjct: 297 DKMSKSKGNVVDPNGLIDEFGADAIRYFLLREINLGQDGNFSRDALIQRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R+++M +K  +G++  P   +E D+S+ +     +    +NM++  +   + +V + 
Sbjct: 357 LLHRTLNMTIKFQNGVLLAPQGESEVDKSLKADAKETVDFFEKNMKDMQLSATIKKVWAF 416

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           +S  ++Y D   PW L K        + V+Y   E +R +++L+  F+P  A +I+  L
Sbjct: 417 ISRANKYIDETTPWALAKDPAKKQELANVMYNLAESLRIISVLISPFMPVTAERIWKQL 475


>gi|213019168|ref|ZP_03334975.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995277|gb|EEB55918.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 472

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/475 (48%), Positives = 318/475 (66%), Gaps = 9/475 (1%)

Query: 39  RLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTT 98
           +L G +V FTTGTDEHGQKI KAA+  G+  K F D+ S  FR +A++++  YDDFIRTT
Sbjct: 2   KLAGKNVKFTTGTDEHGQKIEKAAKTKGIEPKEFTDEISVTFRKLAELMNFDYDDFIRTT 61

Query: 99  EKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQ 158
           E+RH      LW ++ ++G IY   YSGWYS+RDEA+Y + E+  G            VQ
Sbjct: 62  EERHEKAVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELIYGR-----APTGAEVQ 116

Query: 159 WMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGI 218
           W++EE YFFRLS++Q+KLL  YE+ P FI P  R+NEV+SFVKSGL DLS+SR +F+WGI
Sbjct: 117 WIKEESYFFRLSSWQNKLLELYENQPNFIFPESRKNEVVSFVKSGLTDLSISRTSFNWGI 176

Query: 219 KIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPA--DLHVIGKDILRFHAIYWP 276
           K+P++ ++++YVWIDALTNYLT+ G+ +  D    KFW    ++HVIGKDILRFHA+YWP
Sbjct: 177 KVPENDKHVIYVWIDALTNYLTSIGFPNIEDEEYKKFWTNSFNVHVIGKDILRFHAVYWP 236

Query: 277 AFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACG 336
           A LL+A+LPLPK++  HG+ L++GEKISKSLGNVIDPI + EE GVD LRYFL+RE + G
Sbjct: 237 AILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPINLAEEFGVDQLRYFLLREASFG 296

Query: 337 KDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSR 396
           +DG + K  +  R+N++LAN IGNLV R++S + K   G++P        D+  L  C  
Sbjct: 297 QDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCFGVVPVVDRNLLKDDESLPNCKA 356

Query: 397 VLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIR 456
           ++ ++ +++     ++ +  +I++ S+ + Y D   PW L KT+ +R   V+Y  +E IR
Sbjct: 357 IIDQVMDHLSKYEFNQIILLIINISSKANAYIDKSAPWTLSKTDRERMDLVIYKLLEYIR 416

Query: 457 QLAILLQAFVPKLANKIFDILFVADENRCFQSL-DQRLKPGFMLHKTFDPIFPRF 510
            + ILLQ  VPK A  I D L +  E R  +SL +  +  G  L K   PIF RF
Sbjct: 417 MIGILLQPIVPKSAKMILDQLQIPKEQRDLKSLCNACVSLGITLPKP-TPIFLRF 470


>gi|121534360|ref|ZP_01666184.1| methionyl-tRNA synthetase [Thermosinus carboxydivorans Nor1]
 gi|121307130|gb|EAX48048.1| methionyl-tRNA synthetase [Thermosinus carboxydivorans Nor1]
          Length = 640

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 337/514 (65%), Gaps = 14/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YP+ + HIGHAY   IAD +AR+ RL G DV F TG+DEHGQKI + A+
Sbjct: 3   RKSFYITTPIYYPSDRLHIGHAYCTTIADAIARYKRLAGYDVFFLTGSDEHGQKIERKAK 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT   +VD+   +F+ + + L+IS DDFIRTTE RH +  + +++KI D+GDIYK  
Sbjct: 63  EHGVTPIEYVDKIVASFKHLWEKLNISNDDFIRTTETRHKEVVQSIFQKIYDQGDIYKAT 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E ++ + ++    DG+  +    PV+ ++EE YFFRLS YQD+LL Y E +
Sbjct: 123 YEGQYCTPCETFWLERQL---VDGKCPDCGR-PVELVQEESYFFRLSKYQDRLLQYIEEN 178

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+I+F+KSGL+DL +SR TFDWGI +P D ++++YVW DAL NY+T  G
Sbjct: 179 PDFIQPASRRNEMINFIKSGLEDLCVSRTTFDWGIPVPFDTKHVVYVWFDALVNYITAAG 238

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           YL + +    K+WPAD+H++GK+I+RFH I WP  L++  + LPK V+ HG+++ +G+K+
Sbjct: 239 YLHDREKFN-KYWPADVHLVGKEIVRFHTIIWPIILMALGIELPKMVYGHGWLVVEGDKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNVIDP+ +I+E G DA+RYFL++EI  G DG + ++ L  R+NADLAN +GNL+ 
Sbjct: 298 SKSKGNVIDPLALIDEFGADAIRYFLLKEITLGLDGNFSREALISRINADLANDLGNLLH 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R++SMI +   G+I  PGA    D  ++ +         ++M+N  I+ A+ +V  L+  
Sbjct: 358 RTLSMIGRFNGGVIEGPGANEPIDLELVELAQNTAAAYEKHMENMEINAAIKEVWGLIGR 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K  T   R +TVLY   EV+R ++IL+  F+P+ A KI+  L + D
Sbjct: 418 ANKYIDETAPWALAKDATKKSRLNTVLYNLAEVLRIVSILISPFMPQAAPKIWSQLGIED 477

Query: 482 ENRCFQSLDQ-----RLKPGFMLHKTFDPIFPRF 510
            N     LD      +LK G  ++K  +PIFPR 
Sbjct: 478 -NFGNMRLDDAQRWGQLKAGTRVNKP-EPIFPRI 509


>gi|52078533|ref|YP_077324.1| methionyl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|52783895|ref|YP_089724.1| methionyl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|319648562|ref|ZP_08002776.1| MetS protein [Bacillus sp. BT1B_CT2]
 gi|52001744|gb|AAU21686.1| methionyl-tRNA synthetase MetS [Bacillus licheniformis ATCC 14580]
 gi|52346397|gb|AAU39031.1| MetS [Bacillus licheniformis ATCC 14580]
 gi|317389329|gb|EFV70142.1| MetS protein [Bacillus sp. BT1B_CT2]
          Length = 662

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/521 (42%), Positives = 335/521 (64%), Gaps = 12/521 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + 
Sbjct: 3   QEKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQQT 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+   +T +  VD+ + + + +   LDIS DDFIRTTE+RH      +++K+ D GDIY 
Sbjct: 63  AEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHKKVIEKVFQKLLDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
             Y GWYS+ DE +Y + +   V +   G+    +     +PV+ ++EE YFFR+  Y D
Sbjct: 123 DEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL++YE +PEFI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWID
Sbjct: 183 RLLAFYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY+T  G+    D +  K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+H
Sbjct: 243 ALFNYITALGFNTENDENYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+M+ K +DG I +  G  T  DE + S   + ++   + ++N     
Sbjct: 363 LANDLGNLLNRTVAMVNKYFDGRIQSYEGPVTAFDEPLSSFSQKTIEAYEQAIENMEFSV 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELK--KTNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ +   VS  ++Y D   PW L   K       +V+Y   E +R  A+LLQ F+ +  
Sbjct: 423 ALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKELQSVMYHLAESLRITAVLLQPFLTQTP 482

Query: 471 NKIFDILFVADEN-RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            KIF  L V D + + + S+    +   +  +  +P+FPR 
Sbjct: 483 EKIFAQLGVTDASLKTWDSIQSFGQLKSVTVQKGEPLFPRL 523


>gi|319654959|ref|ZP_08009033.1| methionyl-tRNA synthetase [Bacillus sp. 2_A_57_CT2]
 gi|317393384|gb|EFV74148.1| methionyl-tRNA synthetase [Bacillus sp. 2_A_57_CT2]
          Length = 654

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/512 (42%), Positives = 334/512 (65%), Gaps = 14/512 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I YP+   HIGHAY  +  D +AR+ R+ G DV++ TGTDEHGQKI + A+  G
Sbjct: 8   FYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRMRGFDVMYLTGTDEHGQKIQEKAEEKG 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T + +VD+     +++   LDISYDDFIRTT+ RH      ++ ++ ++GDIY G Y G
Sbjct: 68  ITPQQYVDEIVAGIQELWKKLDISYDDFIRTTQDRHKQIVEKIFAQLVEQGDIYLGEYEG 127

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E+YY + ++    DG   +    PV  ++EE YFF++S Y D+LL YYE +P F
Sbjct: 128 WYCTPCESYYTERQL---VDGNCPDCGR-PVHKVKEESYFFKVSKYADRLLQYYEENPSF 183

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P++P++++YVWIDAL+NY+T  GY 
Sbjct: 184 IQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPNNPKHVVYVWIDALSNYITALGYG 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            + D     +WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  K+SK
Sbjct: 244 TDDDSKYLNYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL++R+
Sbjct: 304 SKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERINFDLANDLGNLLNRT 363

Query: 366 VSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           ++M+ K +DG+IP+   +  E D+ +L +    + +  E M+      AL+ V  LVS  
Sbjct: 364 IAMVNKYFDGVIPSYKDSNGEFDQQLLQMNRETVSKYEEAMEKMEFSVALSAVWQLVSRT 423

Query: 425 DRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           ++Y D  +PW L K    R   ++V+    E +R++A+LLQ F+ +   ++F  L V +E
Sbjct: 424 NKYIDETQPWALAKEEEKREDLASVMAHLAESLRRIAVLLQPFLTRTPKEVFSQLNVNEE 483

Query: 483 NRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
                S +   K G +   T     +PIFPR 
Sbjct: 484 --ALTSWESLEKFGLIPEGTKVLKGEPIFPRL 513


>gi|89101166|ref|ZP_01173999.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp.
           NRRL B-14911]
 gi|89084134|gb|EAR63302.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp.
           NRRL B-14911]
          Length = 653

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/510 (43%), Positives = 331/510 (64%), Gaps = 10/510 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I YP+   HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI + A+  G
Sbjct: 8   FYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQQKAEEKG 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           VT + +VD+     +D+   LDISYDDFIRTT+ RH      ++ ++ ++GDIY G Y G
Sbjct: 68  VTPQEYVDEIVDGIKDLWSKLDISYDDFIRTTQDRHKQVVEKIFARLLEQGDIYLGEYEG 127

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E+Y+ + ++    DG   +    PV  ++EE YFF++S Y D+LL YYE +P F
Sbjct: 128 WYCTPCESYFTERQL---VDGNCPDCGR-PVNKVKEESYFFKVSKYADRLLKYYEENPHF 183

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+I+ F+K GL+DL++SR TFDWG+K+PD+P++++YVWIDAL+NY+T  GY 
Sbjct: 184 IQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPDNPKHVVYVWIDALSNYITALGYG 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
              D     +WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  K+SK
Sbjct: 244 TEDDSKYLNYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ +I+  G+D+LRY+L+RE+  G DG +  +G  +RVN DLAN +GNL++R+
Sbjct: 304 SKGNVVDPVTLIDRYGLDSLRYYLLREVPFGADGVFTPEGFVERVNFDLANDLGNLLNRT 363

Query: 366 VSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           V+MI K +DG IP   G+  E D+ +L +    + +  E M+      AL+ V  LVS  
Sbjct: 364 VAMIEKYFDGTIPAYQGSEGEFDKQLLDMNKETVAKYEEAMEKMEFSVALSSVWQLVSRT 423

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV-AD 481
           ++Y D  +PW L K     +    V++   E +R+  +LL+ F+ +  + IF+ L V  +
Sbjct: 424 NKYIDETQPWVLAKDEARKEELGNVMFHLAESLRRTGVLLKPFLTRTPDGIFNQLNVNTE 483

Query: 482 ENRCFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
           E   ++SL+   L P        DPIFPR 
Sbjct: 484 ELTSWESLETFGLIPENTKVVKGDPIFPRL 513


>gi|167042815|gb|ABZ07533.1| putative tRNA binding domain protein [uncultured marine
           microorganism HF4000_ANIW137I15]
          Length = 665

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/518 (43%), Positives = 320/518 (61%), Gaps = 23/518 (4%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  Y++T I Y N  PHIGHAY  I ADVLARFHRL G  V   TGTDEHGQK+ +AA +
Sbjct: 3   ETFYVTTPIYYVNDYPHIGHAYTTIAADVLARFHRLAGTRVFLLTGTDEHGQKVERAALD 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T +   D+    +  + D L I  DDFIRTTE RH      L++++ +KGDIY G Y
Sbjct: 63  RGLTPQGLADRVVGRYHQLWDRLRIEPDDFIRTTEARHRKGVEDLFRRVQEKGDIYLGEY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY   DE+++ + +V  G   +       PV+ + EE YFFR+S YQD+LL + E HP
Sbjct: 123 EGWYCTPDESFWTETQVVDGKCPEC----GRPVERVREESYFFRMSKYQDRLLRHLEEHP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
            FILP  RRNEVI FV+ GL+DLS+SR TF WGI +P    +++YVW DALTNY++  G+
Sbjct: 179 GFILPESRRNEVIRFVEGGLRDLSISRTTFQWGIPVPGGQGHVLYVWFDALTNYISALGF 238

Query: 245 LDNPDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
            +   G     FWPAD+H+IGKDILRFHA+YWP FL+SA LPLP++VF+HG+   +G+K+
Sbjct: 239 GEKNGGEGYETFWPADVHLIGKDILRFHAVYWPTFLMSAELPLPRRVFAHGWWTVEGQKM 298

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSL NV++P  +++  G DA+RYFL+RE+  G+DG +  + L KR+N+DLAN +GNL+ 
Sbjct: 299 SKSLRNVVEPNRLLDRYGADAVRYFLLREVPFGQDGNFSHEALIKRINSDLANDLGNLLH 358

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R++ M+ +   G +P      + +  +          +RE +++    R L +V   + +
Sbjct: 359 RTIGMVEQFCGGRLPRAAEVGDLERGLQQAAGATTAVLREELESLEFQRVLKKVWDFIRQ 418

Query: 424 VDRYFDAQKPWELKKTNPDRA-STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           V++Y DA+ PW L K+  +    T LY   E IR L++ L  F+P  A KI   L +A+E
Sbjct: 419 VNKYLDARAPWSLSKSGDEAGVRTTLYTAAEAIRVLSVWLWPFMPDAALKIRSRLGLAEE 478

Query: 483 N--------RCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
           +        R +  L+  + ++PG        P+FPR 
Sbjct: 479 DPPRSLEEARTWGVLEAGREVQPG-------PPLFPRI 509


>gi|15612616|ref|NP_240919.1| methionyl-tRNA synthetase [Bacillus halodurans C-125]
 gi|25009402|sp|Q9KGK8|SYM_BACHD RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|10172665|dbj|BAB03772.1| methionyl-tRNA synthetase [Bacillus halodurans C-125]
          Length = 660

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/521 (42%), Positives = 337/521 (64%), Gaps = 12/521 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE++  Y++T I YP+ + HIGHAY  +  D +AR+ RL G +V++ TGTDEHGQKI + 
Sbjct: 3   KEQKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYNVMYLTGTDEHGQKIEQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G+T K FVD+     +D+   LDISYDDFIRTTE+RH    + +++++ D+GDIY 
Sbjct: 63  AEAKGLTPKQFVDEIVSGIQDLWKKLDISYDDFIRTTEERHIKVVQQIFEQLLDQGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDDEVYKG---ADGQYYNAQH----NPVQWMEEEGYFFRLSAYQD 174
           G Y GWYS+ DE +Y + ++      ADG     +     +PV+ + E+ YFFR+S Y D
Sbjct: 123 GDYEGWYSIPDETFYTETQLVDKEYDADGNLIGGKSPDSGHPVEKVREQSYFFRMSKYAD 182

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +YE +P+FI P  R+NE+I+ F+K GL+DL++SR +F WG+ +P DP++++YVWID
Sbjct: 183 RLLQFYEENPQFIQPESRKNEMINNFIKPGLEDLAVSRTSFTWGVPVPRDPKHVVYVWID 242

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY+T  GY  +       +WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF H
Sbjct: 243 ALSNYITALGYGSDQQEKYENYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFGH 302

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +RVN D
Sbjct: 303 GWLLMKDGKMSKSKGNVVDPVPLIDRYGLDALRYYLLREVPFGSDGVFTPEAFVERVNYD 362

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K +DG IP+     T  D  ++ +    ++++ + M+      
Sbjct: 363 LANDLGNLLNRTVAMIEKYFDGKIPSYVKDGTPFDADLVELVYSTVKKVEDAMEEMEFSI 422

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLA 470
           AL  +  L+S  ++Y D  +PW L K    R      +Y   E IR +++LLQ F+ K  
Sbjct: 423 ALTAIGQLISRTNKYIDETQPWVLAKDESKREQLGAAMYHLAESIRYVSVLLQPFMTKAP 482

Query: 471 NKIFDILFVADENRCFQSLDQRLK-PGFMLHKTFDPIFPRF 510
            KI++ L +      ++SL+   + PG    +   P+FPR 
Sbjct: 483 QKIWEQLGIDSSLTTWESLETFGQIPGNTNVQKGQPLFPRL 523


>gi|135148|sp|P23920|SYM_BACST RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|39989|emb|CAA40999.1| methionine--tRNA ligase [Geobacillus stearothermophilus]
          Length = 649

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/516 (43%), Positives = 329/516 (63%), Gaps = 14/516 (2%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           E++  Y++T I YP+ + HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI + A
Sbjct: 2   EKKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q  GVT + +VD      +++   LDISYDDFIRTT++RH      ++ ++ ++GDIY G
Sbjct: 62  QEKGVTPQQYVDDIVAGIQELWRKLDISYDDFIRTTQERHKKIVEKIFARLVEQGDIYLG 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E++Y + ++    DG   +    PV+ ++EE YFFR+S Y D+LL YYE 
Sbjct: 122 EYEGWYCTPCESFYTERQL---VDGNCPDC-GRPVEKVKEESYFFRMSKYVDRLLQYYEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P DP++++YVWIDAL NY+T 
Sbjct: 178 NPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF HG++L K  
Sbjct: 238 LGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVMIIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           + R+V+MI K + G IP   G  T  D  +      V+++  E M+      AL+ V  L
Sbjct: 358 LHRTVAMIEKYFGGAIPPYRGPKTPFDRDLSETAREVVRQYEEAMERMEFSVALSAVWQL 417

Query: 421 VSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +   ++Y D  +PW L K    R   ++V+    E +R  A+LLQ F+ +   +IF  L 
Sbjct: 418 IGRTNKYIDETQPWVLAKEESKREELASVMAHLAESLRYTAVLLQPFLTRTPERIFTQLG 477

Query: 479 VADENRCFQSLDQRLKPGFMLHKT----FDPIFPRF 510
           ++D  R  +  D     G +   T     +P+FPR 
Sbjct: 478 ISD--RSLKEWDSLYDFGLIPEGTNVQKGEPLFPRL 511


>gi|315301039|ref|ZP_07872357.1| methionyl-tRNA synthetase [Listeria ivanovii FSL F6-596]
 gi|313630592|gb|EFR98407.1| methionyl-tRNA synthetase [Listeria ivanovii FSL F6-596]
          Length = 664

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/522 (43%), Positives = 341/522 (65%), Gaps = 13/522 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E+   YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI   
Sbjct: 4   EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAK 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G++ + +VD+ +  F+++   L+IS  DFIRTT+ RH  +   +++++ ++GDIY 
Sbjct: 64  AKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVAKIFEQLVEQGDIYL 123

Query: 122 GCYSGWYSLRDEAYYND---DEVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +   +EVYK   G+    +    N V+ ++EE YFFR+S Y D+
Sbjct: 124 GEYEGWYSVSDEEYFTETQLEEVYKDESGKVIGGKAPSGNEVELVKEESYFFRMSKYADR 183

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           L+ YY SHPEFILP  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDA
Sbjct: 184 LVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDA 243

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + D    K+WPAD+ ++GK+I+RFH IYWP  L++ +LPLPK VF HG
Sbjct: 244 LSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHG 303

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DALRY+L+RE+  G DG +  +    RVN DL
Sbjct: 304 WILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDL 363

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K ++G IP   G  T  D++++   + V+ +  ++M +     A
Sbjct: 364 ANDLGNLLNRTVAMINKYFNGEIPAYQGDVTPFDKTLVDFKNSVVLDYEKSMDHMQFSVA 423

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L Q+ SL+S  ++Y D      L K    RA  ++V+    E +R +A+LLQ F+ +   
Sbjct: 424 LNQLWSLISRTNKYIDETAXXALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRTPG 483

Query: 472 KIFDILFVADEN-RCFQSL--DQRLKPGFMLHKTFDPIFPRF 510
           +IF  L + +EN + + S+     +  G  + K   PIFPR 
Sbjct: 484 EIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRL 525


>gi|310830112|ref|YP_003962469.1| methionyl-tRNA synthetase [Eubacterium limosum KIST612]
 gi|308741846|gb|ADO39506.1| methionyl-tRNA synthetase [Eubacterium limosum KIST612]
          Length = 648

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/515 (43%), Positives = 334/515 (64%), Gaps = 10/515 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M+E++  Y++T I YP+   HIGH Y  + AD L RF +L G D  F TGTDEHGQKI K
Sbjct: 2   MEEKKTFYVTTPIYYPSGDLHIGHTYTTVAADTLTRFKKLTGYDAYFLTGTDEHGQKIQK 61

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  GVT + +VD      +++  +++I+YD FIRTT+  H  T + ++KK+ D+GDIY
Sbjct: 62  AAEEKGVTPQAYVDDVVGRIKELWKLMNINYDQFIRTTDPEHEKTIQQIFKKLYDQGDIY 121

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y GWY    E+++ + ++    DG   +    PV+   EE YFF++S Y D+LL Y 
Sbjct: 122 KGKYEGWYCTPCESFWTESQL---VDGNCPDCGR-PVEKASEEAYFFKMSKYADRLLKYI 177

Query: 181 ESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           E HP+FI P  R+NE+I+ F+K GL+DL +SR +F WG+ +  DP +++YVWIDAL NY+
Sbjct: 178 EDHPDFIQPESRKNEMINNFIKPGLQDLCVSRTSFSWGVPVTFDPGHVVYVWIDALPNYI 237

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           +  GYL++      K+WPA++H++GKDI+RFH IYWP  L++ +LPLP+ V+ HG+IL K
Sbjct: 238 SALGYLNDKPQLMDKYWPANVHLVGKDIIRFHTIYWPIILMALDLPLPEHVYGHGWILLK 297

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           G K+SKS+GNV+DP+E+ E+ GVDALRY ++RE+  G DG Y++D L   +N+DLAN +G
Sbjct: 298 GGKMSKSVGNVVDPVELAEKYGVDALRYHVLREMTYGADGIYNEDLLVSHINSDLANDLG 357

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NL+SR+V+M +K +DG+IP      + D  ++++       + + M      RAL  V  
Sbjct: 358 NLLSRTVAMTVKYFDGVIPAERESGDFDAELIALAEETPGVVEDYMNKLDFSRALEAVWK 417

Query: 420 LVSEVDRYFDAQKPWELKKTNPD---RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
           LVS  ++Y D  +PW L K +P+   R + V+Y   E +R +++L+ + +P    KI D 
Sbjct: 418 LVSRTNKYIDETQPWVLIK-DPEKKARLAMVMYNLTESLRIISVLVSSAMPDTGVKIADE 476

Query: 477 LFVADENRCFQSLDQRLK-PGFMLHKTFDPIFPRF 510
           L V +E R ++S+    K P  +  +  +PIFPR 
Sbjct: 477 LKVPEELRTWESIQSFGKYPDGIQVERCEPIFPRI 511


>gi|260584776|ref|ZP_05852521.1| methionine--tRNA ligase [Granulicatella elegans ATCC 700633]
 gi|260157433|gb|EEW92504.1| methionine--tRNA ligase [Granulicatella elegans ATCC 700633]
          Length = 670

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 337/523 (64%), Gaps = 15/523 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           ++++  Y++T I YP+ Q HIGHAY  + +D + R+ +L G D  F TGTDEHGQKI + 
Sbjct: 3   EDKKTFYLTTPIYYPSGQLHIGHAYTTVASDAMIRYKKLQGYDTYFLTGTDEHGQKIQQK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           AQ AGV+   FVD      +D+   LD+SYDDFIRTT+ RH  + + +++K+ D GDIY 
Sbjct: 63  AQEAGVSEIEFVDNIIFGIQDLWKKLDVSYDDFIRTTQPRHKKSVQKIFQKLMDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDD---EVYKGADGQYYNA---QHNPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +    EVY+ ADG+         + VQ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTESQLVEVYRDADGKMIGGVAPSGHEVQLVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           LL YYE HPEFI P  R+NE+I+ F+K GL+DL++SR +FDWGI +P+DP++++YVWIDA
Sbjct: 183 LLQYYEEHPEFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIPVPNDPKHVIYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + +    ++WPAD+H IGK+I+RFH IYWP  L++ +LPLPKK+F+HG
Sbjct: 243 LSNYITALGYGSDDETLFNRYWPADVHFIGKEIVRFHTIYWPIMLMALDLPLPKKIFAHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           ++L K  K+SKS GNV+DP  +IE  G+DALRY+L+RE+  G DG +  +   +R+N DL
Sbjct: 303 WLLMKDGKMSKSKGNVVDPNTLIERYGLDALRYYLLREVPFGSDGIFTPESFVERINYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPTPGAFTES-DESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IPT  A   S D  ++     +++E+   M+      A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGTIPTYSAPVSSFDHELVEASKVMIEEVEAAMEEMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKK---TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           L+ +   VS  ++Y D   PW   K      + A T+ Y+  E +R +A+ LQ F+ +  
Sbjct: 423 LSAIWKFVSRTNKYIDETTPWAAVKDEARQEELARTMSYLA-ESLRIIAVALQPFLTQTP 481

Query: 471 NKIFDILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            +I   L + DE  R + SL     +  G  + +   PIFPR 
Sbjct: 482 GEILAQLGIHDEALRDYPSLHTFGVIPAGTTVVEKGQPIFPRL 524


>gi|313895444|ref|ZP_07829001.1| methionine--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976339|gb|EFR41797.1| methionine--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 514

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/515 (43%), Positives = 331/515 (64%), Gaps = 11/515 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   YI+T I YP+A+ HIGHAY   +AD +ARF RL G DV F TG+DEHGQKI +
Sbjct: 1   MSEKTPFYITTPIYYPSAKLHIGHAYCTTVADTIARFKRLAGYDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  GVT + +VD+    F+++  +L ISYDDFIRT+E+RHH+  + ++++I D+GDIY
Sbjct: 61  AAEKEGVTPQAYVDRIVAGFQELWQLLGISYDDFIRTSEERHHELVQNIFQQIYDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+   E+    +G   +  H PVQ + EE YFFR+S Y D++L+Y 
Sbjct: 121 KGEYKGLYCTPCESYWT--ELQLDENGNCPDC-HRPVQEVSEEAYFFRMSKYADRVLAYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           + HP+FI P+ RRNE+ISF++ GL+DL +SR +FDWGI +P DP++++YVW DALTNYLT
Sbjct: 178 KEHPDFIQPVSRRNEMISFIEQGLEDLCVSRTSFDWGIPVPFDPKHVVYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY+ + + +  K+WP D+H++GK+I+RFH I W   L++  L LPKKV+ HG+++  G
Sbjct: 238 PIGYMHDKE-TFHKYWPCDVHLVGKEIVRFHTIIWGCMLMALGLALPKKVYGHGWLIVDG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DPI +IEE G DA+RYFL+REI  G+DG   +D L  R+N+DLAN +GN
Sbjct: 297 AKMSKSVGNVVDPIALIEEFGADAIRYFLLREITLGQDGNISRDALINRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R++SM  K   G+I      T  D S+  + +  ++     M+   +  A+  V + 
Sbjct: 357 LLHRTLSMAKKYRGGVIVKGTGETAFDASLEEIAAETVKMYTAQMEAMELSPAIRTVWAF 416

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++  ++Y D   PW L K      +  +VLY  VE +   +IL+  F+P  A +I   L 
Sbjct: 417 IARTNKYIDETAPWTLAKDEAKAGQLDSVLYHLVEALHITSILIAPFMPVTARRIHAQLG 476

Query: 479 VADENRCFQSLD----QRLKPGFMLHKTFDPIFPR 509
            AD+    Q  D     R+  G  +  T + +FPR
Sbjct: 477 FADDFDAVQLADIAHWGRVAEGHTV-GTAEQLFPR 510


>gi|259047680|ref|ZP_05738081.1| methionine--tRNA ligase [Granulicatella adiacens ATCC 49175]
 gi|259035871|gb|EEW37126.1| methionine--tRNA ligase [Granulicatella adiacens ATCC 49175]
          Length = 670

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 334/523 (63%), Gaps = 15/523 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           ++++  Y++T I YP+   HIGHAY  + +D + R+ +L G D  F TGTDEHGQKI + 
Sbjct: 3   EDKKTFYLTTPIYYPSGNLHIGHAYTTVASDAMVRYKKLQGFDTYFLTGTDEHGQKIQEK 62

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+ AGV+   FVD+     +D+   LDISYDDFIRTT+ RH    + +++K+ D GDIY 
Sbjct: 63  AKEAGVSEIEFVDKIIFGIQDLWKELDISYDDFIRTTQPRHTKAVQKIFQKLVDNGDIYL 122

Query: 122 GCYSGWYSLRDEAYYNDD---EVYKGADGQYYNA---QHNPVQWMEEEGYFFRLSAYQDK 175
           G Y GWYS+ DE Y+ +    EVY+ A+G          + V+ ++EE YFFR+S Y D+
Sbjct: 123 GEYEGWYSVSDEEYFTETQLVEVYRDAEGNMIGGVAPSGHEVELVKEESYFFRMSKYADR 182

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           LL YYE HP+FI P  R+NE+I+ F+K GL+DL++SR +FDWGI +P+DP++++YVWIDA
Sbjct: 183 LLQYYEEHPDFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGIPVPNDPKHVVYVWIDA 242

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L+NY+T  GY  + +    ++WPAD+H IGK+I+RFH IYWP  L++ +LPLPKK+F+HG
Sbjct: 243 LSNYITALGYGSDDETLFNRYWPADVHFIGKEIVRFHTIYWPIMLMALDLPLPKKIFAHG 302

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           ++L K  K+SKS GNV+DP  +IE  G+DALRY+L+RE+  G DG +  +   +R+N DL
Sbjct: 303 WLLMKDGKMSKSKGNVVDPNTLIERYGLDALRYYLLREVPFGSDGIFTPESFVERINYDL 362

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPTPGAFTES-DESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNL++R+V+MI K +DG IP   A   S D+ ++     ++ E+ E M+N     A
Sbjct: 363 ANDLGNLLNRTVAMINKYFDGTIPAYTAPVSSFDQELVDASKAMIVEVEEAMENMQFSVA 422

Query: 414 LAQVISLVSEVDRYFDAQKPWELKK---TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           LA +   VS  ++Y D   PW   K      + A T+ Y+  E +R +A+ LQ F+ +  
Sbjct: 423 LAAIWKFVSRTNKYIDETTPWAAVKDEARQEELARTMNYLA-ESLRIIAVALQPFLTQTP 481

Query: 471 NKIFDILFVADENRC-FQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            +I   L + D     + SL     +  G  + +   PIFPR 
Sbjct: 482 GEILAQLGITDSALMDYPSLHTFGVIPEGTKVVEKGQPIFPRL 524


>gi|309390254|gb|ADO78134.1| methionyl-tRNA synthetase [Halanaerobium praevalens DSM 2228]
          Length = 653

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/514 (42%), Positives = 336/514 (65%), Gaps = 9/514 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  Y++T I YP+ + HIGHAY  + AD +AR+ ++ G D +F TG+DEHGQKI + AQ
Sbjct: 3   KDTYYVTTPIYYPSDKLHIGHAYTTVAADTIARYKKMRGFDTMFLTGSDEHGQKIERKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG   K +VDQ    F+++ D LDI YD FIRTTE RH    + +++K+ D+GDIYKG 
Sbjct: 63  AAGKEAKEYVDQIVATFKNLWDKLDIEYDYFIRTTEARHEKVVQQIFEKLYDQGDIYKGK 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    EA++ + ++ +  + +     H  V+W+EEE YFF++S Y D+LL + + H
Sbjct: 123 YEGWYCTPCEAFWTERQLEEAKEEKVCPDCHREVEWVEEESYFFKMSKYADRLLEHIKDH 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNE+I+F+++GL DLS+SR TF+WGI +P D  +++YVWIDAL+NYLT  G
Sbjct: 183 PEFIEPESRRNEMINFIENGLDDLSVSRTTFEWGIPVPIDDDHVIYVWIDALSNYLTAIG 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  + +  + K+WPADLH++GKDILRFH I WP  +++ +L LPK+VF HG++L +  K+
Sbjct: 243 YQTDQENFE-KYWPADLHLVGKDILRFHTIIWPIIIMALDLELPKQVFGHGWLLSETGKM 301

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP+ +I++ G DA+RY+L+RE+A G DG Y  + L +R+N+DLAN +GNL++
Sbjct: 302 SKSKGNVVDPVVLIDDFGKDAIRYYLLREVAFGTDGKYSTESLIQRINSDLANDLGNLLN 361

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+VSM+ + +D  IP      + D+ ++ + ++  +E+   M+      AL ++ + V  
Sbjct: 362 RTVSMVDQYFDSEIPKVAEKADLDQELIDLAAQTKKEVEIEMEKLKYTVALEKIWNFVRR 421

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVP----KLANKIFDIL 477
            ++Y D   PW L K     DR  TVLY  +E +R +A++L+ F+     K+  ++  + 
Sbjct: 422 TNKYIDQTSPWLLAKEPAKRDRLKTVLYNLLESLRIIAVMLKPFLTEAPFKMGQQLGQLE 481

Query: 478 FVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL 511
            + D +    +    LK G  + K  +P+FPR +
Sbjct: 482 AIEDADWEAATWGS-LKTGVKV-KNGEPMFPRIV 513


>gi|154684557|ref|YP_001419718.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42]
 gi|154350408|gb|ABS72487.1| MetS [Bacillus amyloliquefaciens FZB42]
          Length = 663

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/516 (42%), Positives = 330/516 (63%), Gaps = 12/516 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI + A+   
Sbjct: 8   FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQKAEEEN 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T + +VD+     + +   LDIS+DDFIRTTE RH +    +++K+ D GDIY   Y G
Sbjct: 68  ITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDIYLDEYEG 127

Query: 127 WYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQDKLLSY 179
           WYS+ DE +Y + +   V +   G+    +     +PV+ ++EE YFFR+S Y D+LL +
Sbjct: 128 WYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKYADRLLKF 187

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+P +P++++YVWIDAL NY
Sbjct: 188 YEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVWIDALFNY 247

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T  GY    D    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPK+VF+HG++L 
Sbjct: 248 ITALGYDTENDELYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAHGWLLM 307

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP+ +IE  G+D LRY+L+RE+  G DG +  +G  +R+N DLAN +
Sbjct: 308 KDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYDLANDL 367

Query: 359 GNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNL++R+V+MI K +DG I +  G  T+ D  + SV    ++   + M+N     AL+ +
Sbjct: 368 GNLLNRTVAMIQKYFDGEIGSYEGNVTDFDSELSSVAGETVKAYEKAMENMEFSVALSTL 427

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
             L+S  ++Y D   PW L K         +V+Y   E +R  A+LLQ F+ +   K+F 
Sbjct: 428 WQLISRTNKYIDETAPWVLAKDQEKEKELRSVMYHLAESLRISAVLLQPFLTQTPEKMFA 487

Query: 476 ILFVADEN-RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
            L V D++ + + S+    +      K  +P+FPR 
Sbjct: 488 QLGVEDQSLKAWDSIQTFGQLKNAKVKKGEPLFPRL 523


>gi|225181535|ref|ZP_03734977.1| methionyl-tRNA synthetase [Dethiobacter alkaliphilus AHT 1]
 gi|225167783|gb|EEG76592.1| methionyl-tRNA synthetase [Dethiobacter alkaliphilus AHT 1]
          Length = 652

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/513 (43%), Positives = 330/513 (64%), Gaps = 9/513 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +++  YI+T I YP+ + HIGH+Y  + AD +ARF RL G    F TGTDEHGQKI + A
Sbjct: 2   QKKSFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGHQAYFLTGTDEHGQKIERRA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           Q AG   + FVD+     + +  VLDISYDDFIRTTE+RH D+ + ++ K  ++GDIYK 
Sbjct: 62  QEAGKEPQEFVDEIVDWIKKLWTVLDISYDDFIRTTEQRHKDSVQKIFTKFYEQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    EA++ + +V +G           PV+ + EE YFF++S Y D+L+ + E+
Sbjct: 122 KYEGWYCTPCEAFWTERQVEEGNCPDC----KRPVELVAEESYFFKMSKYADRLIEHIEN 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +PEFI P  R+NE+I+ F+K GL+DL +SR TF WGI +P DP +++YVW+DAL+NY+T 
Sbjct: 178 NPEFIQPASRKNEMINNFLKPGLEDLCVSRTTFKWGIPVPFDPDHVIYVWLDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GYL   D     FWPAD+ +IGK+I+RFH IYWP FL++  L LPK+VF HG++L +  
Sbjct: 238 LGYLSEDDSKMKAFWPADVQLIGKEIVRFHTIYWPIFLMALGLELPKQVFGHGWLLLEEG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNVIDP  ++E  G DA+RYFL+REI  G DG + ++ L +R+N DLAN +GNL
Sbjct: 298 KMSKSKGNVIDPEVLVERYGSDAIRYFLLREIPFGADGHFSEEALIQRLNFDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           ++R+++M+ K Y G +PTP      DE + S+   + Q++ E M   L   AL+++   +
Sbjct: 358 LNRTLAMLNKYYQGKVPTPSLDEAIDEELKSMALDLPQKMTERMDQLLFSNALSELWKFI 417

Query: 422 SEVDRYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           +  ++Y D   PW L K+ N  R +TV+Y  +E IR +++LL  F+P+   +I+  L +A
Sbjct: 418 ARANKYIDETAPWTLAKEGNQQRLATVMYNLLESIRIVSVLLLPFMPRTPERIWQQLGIA 477

Query: 481 DENR--CFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
            E +   + S+ +    P     K  + +FPR 
Sbjct: 478 HEGKIHTWDSIQEFGALPAGAQTKAAEVLFPRL 510


>gi|310642692|ref|YP_003947450.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Paenibacillus
           polymyxa SC2]
 gi|309247642|gb|ADO57209.1| Methionyl-tRNA synthetase (Methionine--tRNA ligase) [Paenibacillus
           polymyxa SC2]
          Length = 672

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/524 (43%), Positives = 337/524 (64%), Gaps = 15/524 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M      YI+T I YP+ + HIGHAY  +  D +AR+ RL G +V + TGTDEHGQKI +
Sbjct: 1   MSSENTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYEVRYLTGTDEHGQKIEQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A  AG T + FVD      +D+   LDIS DDFIRTTE+RH    + ++ ++  +GDIY
Sbjct: 61  KASAAGKTPQRFVDDIVAGIQDLWRKLDISNDDFIRTTEERHKAVVQEIFDRLLKQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQ 173
           KG Y GWYS+ DE YY + +   V K A+G     +     +PV+ ++EE YFFR+S Y 
Sbjct: 121 KGEYEGWYSIPDETYYTETQLVDVVKDAEGNVTGGKSPDSGHPVELVKEESYFFRMSKYA 180

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL +YE +P+FI P  R+ E+I+ F+K GL+DL++SR TFDWG+K+  DP++++YVWI
Sbjct: 181 DRLLQFYEENPQFIQPESRKKEMINNFIKPGLEDLAVSRTTFDWGVKVKGDPKHVVYVWI 240

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL+NY+T  GY  +      KFWPA++H++GK+I+RFH IYWP  L++ +LPLPKKVF+
Sbjct: 241 DALSNYITALGYGSSNTELYDKFWPANVHIVGKEIVRFHTIYWPIMLMALDLPLPKKVFA 300

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG++L K  K+SKS GNV+DP+ +I+  G+D LRY+L+RE+  G DG +  +    RVN+
Sbjct: 301 HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDQLRYYLLREVPFGADGTFTPESFVDRVNS 360

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNL++R+V+M+ K +DG +P   A  T  D +++ + +    ++ E M+N    
Sbjct: 361 DLANDLGNLLNRTVAMVDKYFDGKVPAYEANVTSFDAALVDMATSTYSKVEEAMENMEFS 420

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKL 469
            AL  +   +S  ++Y D  +PW L K    R+  ++V+   VE +R  +ILLQ F+ + 
Sbjct: 421 VALTAISQFISRSNKYIDETQPWNLAKDEEKRSELASVMVHLVESLRIASILLQPFLTRA 480

Query: 470 ANKIFDILFV-ADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            ++I++ L +   E   + S  Q  R+  G  L K  +PIFPR 
Sbjct: 481 PHQIWEQLGIRQGELTTWDSGKQFGRIPEGTQLVKG-NPIFPRL 523


>gi|212637881|ref|YP_002314401.1| methionyl-tRNA synthetase [Anoxybacillus flavithermus WK1]
 gi|212559361|gb|ACJ32416.1| Methionyl-tRNA synthetase [Anoxybacillus flavithermus WK1]
          Length = 656

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/515 (42%), Positives = 330/515 (64%), Gaps = 14/515 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGHAY  +  D +AR+ R+ G DV++ TGTDEHGQKI + A+
Sbjct: 10  KKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKAE 69

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT + +VD+     +++   LDISYDDFIRTTE+RH      ++ ++ ++GDIY   
Sbjct: 70  EKGVTPQQYVDEIVAGIKELWKKLDISYDDFIRTTEQRHKQVVEKIFARLLEQGDIYLDE 129

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E++Y + ++ +G           PV+ ++E+ YFFR+S Y D+LL++YE +
Sbjct: 130 YEGWYCTPCESFYTERQLVEGNCPDC----GRPVEKVKEQSYFFRMSKYVDRLLAFYEEN 185

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P+FI P  R+NE+I+ F+K GL+DL++SR TFDWGI +P DP++++YVWIDAL+NY+T  
Sbjct: 186 PQFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIPVPGDPKHVIYVWIDALSNYITAL 245

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY    D     +WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L K  K
Sbjct: 246 GYGTENDEKYKTYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGK 305

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +G  +R+N DLAN +GNL+
Sbjct: 306 MSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLL 365

Query: 363 SRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +R+V+MI K + G +P   G  T  DE ++ +    +++  E M+     +AL  V  L+
Sbjct: 366 NRTVAMIEKYFAGRVPVYSGTHTSFDEQLVQMAYDTVRQYEEAMEQMQFSQALTAVWQLI 425

Query: 422 SEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D  +PW L K    R   ++V+    E +R +A+LLQ F+     ++F  L +
Sbjct: 426 SRTNKYIDETQPWVLAKDEATREQLASVMSHLAESLRYVAVLLQPFLTATPKRMFAQLGI 485

Query: 480 ADENRCFQSLDQRLKPGFMLHKTF----DPIFPRF 510
            DE     S D     G   H+       P+FPR 
Sbjct: 486 QDEK--LMSWDSLQTFGASQHERMVEKGAPLFPRL 518


>gi|317126779|ref|YP_004093061.1| methionyl-tRNA synthetase [Bacillus cellulosilyticus DSM 2522]
 gi|315471727|gb|ADU28330.1| methionyl-tRNA synthetase [Bacillus cellulosilyticus DSM 2522]
          Length = 656

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/513 (42%), Positives = 338/513 (65%), Gaps = 10/513 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  Y++T I YP+ + HIGHAY  +  D +AR+ RL G DV+F TGTDEHGQKI + A+
Sbjct: 5   RKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMFLTGTDEHGQKIERKAE 64

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           + GV+ + FVD   +  + +   LDISYDDFIRTTE+RH    + ++ ++  +GDIY   
Sbjct: 65  DKGVSPQQFVDDIVKTIKSLWSKLDISYDDFIRTTEERHKKVVQKIFDQLLQQGDIYLDQ 124

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+++ D   Y+  DG+  +    PV+ ++EE YFFR+S Y D+LL YYE +
Sbjct: 125 YEGLYCTPCESFFTD---YQAKDGKCPDCSR-PVEKVQEESYFFRMSKYADRLLKYYEEN 180

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P+FI P  R+NE+I+ F+K GL+DL++SR +FDWGI +  +P++++YVWIDAL+NY+T  
Sbjct: 181 PDFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGINVKSNPEHVVYVWIDALSNYITAL 240

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY  + +    K+WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF HG++L K  K
Sbjct: 241 GYGSDDETLYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGK 300

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+DP+ +IE  G+DALRY+L+RE+  G DG +  +G   RVN DLAN +GNL+
Sbjct: 301 MSKSKGNVVDPVPLIERYGLDALRYYLLREVPFGSDGTFTPEGFVDRVNYDLANDLGNLL 360

Query: 363 SRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +R+V+MI K +DG +P      T  DES++   +  ++++ + M++     AL  +  LV
Sbjct: 361 NRTVAMINKYFDGEMPKYIKNATSYDESLVDHVNATVKKVEDAMEDMEFSVALTAIWQLV 420

Query: 422 SEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D  +PW + +  T  ++  +V+Y   E +R ++IL+Q F+ +   KI++ L +
Sbjct: 421 SRTNKYIDETQPWIIARDETAKEQLGSVMYHLAESLRYISILIQPFLTEAPKKIWEQLGI 480

Query: 480 ADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            ++   + +L    + + G  +    +P+FPR 
Sbjct: 481 TEDQTVWSTLQDFGKTESGTKVVTKGEPLFPRL 513


>gi|330814121|ref|YP_004358360.1| methionyl-tRNA synthetase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487216|gb|AEA81621.1| methionyl-tRNA synthetase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 481

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/487 (44%), Positives = 314/487 (64%), Gaps = 15/487 (3%)

Query: 22  IGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFR 81
           +GHAY  I AD +AR+ RL+G DV F TGTDEHGQKI K+A    ++  VF ++ S+ F 
Sbjct: 1   MGHAYSSISADFIARYKRLEGYDVKFVTGTDEHGQKIQKSADKRKLSPNVFCNEISKVFL 60

Query: 82  DMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEV 141
           D+   L++S  DFIRTTE RHH T + LWK + +K  IY   YSGWYS+ DEA+Y + E+
Sbjct: 61  DLTKTLNLSNTDFIRTTEDRHHKTVQKLWKILEEKKFIYLSKYSGWYSVSDEAFYTESEI 120

Query: 142 YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVK 201
            +  + +   A  + V+W+EEE YFF+LS +Q+ L+ +YE +PEFI P  RRNEV+SFVK
Sbjct: 121 IEKDNIKLSVASGSAVEWVEEESYFFKLSQFQNLLIKHYEDNPEFIQPSSRRNEVMSFVK 180

Query: 202 SGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLH 261
            GL DLS+SR +F WGI +P+   +I+YVW+DALTNYLT T Y D         WPAD+H
Sbjct: 181 GGLNDLSISRNSFKWGISVPNSKDHIIYVWLDALTNYLTATNYFDENSS-----WPADVH 235

Query: 262 VIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVG 321
           +IGKDILRFHA+YWPAFLL+A +PLPK +F HG+IL   EK+SKS GN++DPIEV+ E G
Sbjct: 236 IIGKDILRFHAVYWPAFLLAAEIPLPKTIFGHGWILSGDEKMSKSKGNILDPIEVVNEFG 295

Query: 322 VDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPG 381
           +D +RY+L++E+  G DG  + D LK  +N+DLAN IGNL  R   +I K +   +P P 
Sbjct: 296 LDEIRYYLMKEVMYGLDGNINIDNLKNCINSDLANNIGNLSQRIFVLINKYFSCKVPDPK 355

Query: 382 AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNP 441
              + D+  +  C   ++ +R++M +  IH  + +VIS  S+++++ + ++PW   K + 
Sbjct: 356 PLLKDDQKFMD-CP--VEGLRKSMDSFEIHNYIREVISYSSKINKFVNDEEPWTKAKNSD 412

Query: 442 DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLK------- 494
            R  T+LY+ +  ++ + ILL   +P  +      L V  +N   + +++ L        
Sbjct: 413 PRVGTILYIALNALKNIFILLHPVMPSKSEYYLSCLNVDTKNISLELINKNLPINVELKM 472

Query: 495 PGFMLHK 501
           PG M  K
Sbjct: 473 PGLMFKK 479


>gi|226309673|ref|YP_002769567.1| methionyl-tRNA synthetase [Brevibacillus brevis NBRC 100599]
 gi|226092621|dbj|BAH41063.1| methionyl-tRNA synthetase [Brevibacillus brevis NBRC 100599]
          Length = 675

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 317/475 (66%), Gaps = 4/475 (0%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           YI+T I YP+ + HIG+AY  I  D LAR+ RL G DV + TGTDEHGQK+ + A   G 
Sbjct: 6   YITTPIYYPSNKLHIGNAYTTIACDALARYKRLRGYDVYYLTGTDEHGQKLQERAAEEGK 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
               F+D      +D+ + LDISYDDFIRTTE RH +  + +++++ D+GDIY G Y G+
Sbjct: 66  QPLEFIDPIVDWVKDLWEKLDISYDDFIRTTEPRHKEVVQKVFQRLLDQGDIYLGEYEGF 125

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y + DEA++ + +  K  +G         V+ ++E+ YFFR+S YQD+LL++ E++PEFI
Sbjct: 126 YCVPDEAFWTETQC-KTDNGYICPDCGREVKKVKEKNYFFRMSKYQDRLLAHIEANPEFI 184

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  RRNE+++ F+K GL+DLS+SR TFDWGIK+P DP++++YVWIDALTNY++  GYL 
Sbjct: 185 QPESRRNEMVNNFLKPGLQDLSVSRSTFDWGIKVPTDPEHVIYVWIDALTNYISALGYLS 244

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D     FWPA++H++GKDILRFH IYWP  L++ ++PLPK++F HG++L    K+SKS
Sbjct: 245 EDDSKYRNFWPANVHMVGKDILRFHTIYWPILLMALDIPLPKQIFGHGWLLMPDGKMSKS 304

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNVIDP  +I+  G D +RYFL+REI  G+DG +  +   +R+N DLAN IGNL+SR+ 
Sbjct: 305 KGNVIDPKVLIDRYGSDGVRYFLLREINFGQDGIFTPESFVQRLNYDLANDIGNLLSRTA 364

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG++P P    E D+S++ +  +    + E+M+      ALA +  LV   ++
Sbjct: 365 TMIEKYFDGIVPAPQDAGEPDDSLIGLAMKTKALVEEHMEEMRFSNALAHIWELVGRTNK 424

Query: 427 YFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           Y D   PW L K+     R +TV+Y  VE IR  ++L+Q F+ K   KI+D L +
Sbjct: 425 YIDETMPWNLAKSEETKGRLATVMYNLVESIRISSVLIQPFMTKAPAKIWDQLGI 479


>gi|205372010|ref|ZP_03224828.1| methionine-tRNA ligase/methionyl-tRNA synthetase [Bacillus
           coahuilensis m4-4]
          Length = 652

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 222/518 (42%), Positives = 339/518 (65%), Gaps = 12/518 (2%)

Query: 1   MKER-EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           M+E+    YI+T I YP+   HIGHAY  +  D +AR+ RL G DV++ TGTDEHGQKI 
Sbjct: 1   MQEKLNTFYITTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGFDVMYLTGTDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           + A+   VT   +VD+  +  +D+ + LDISYDD+IRTTE RH      ++ ++ ++GDI
Sbjct: 61  RKAEEQNVTPIEYVDEIVKGVKDLWEKLDISYDDYIRTTESRHKQVVEKIFAQLVEQGDI 120

Query: 120 YKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           Y   Y GWY    E+++ + ++    DG+  +     V+ ++EE YFF++S Y D+LL Y
Sbjct: 121 YLDQYEGWYCTPCESFFTERQL---VDGKCPDCGRE-VEKVKEESYFFKVSKYADRLLQY 176

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +P FI P  R+NE+I+ F+K GL+DL++SR TFDWGIK+P +P++++YVWIDAL+NY
Sbjct: 177 YEENPGFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNY 236

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           ++  GY    D     +WPAD+H++GK+I+RFH IYWP  L++ +LPLPKKVF+HG++L 
Sbjct: 237 ISALGYGSEDDHKYVNYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLM 296

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP+ +I+  G+D+LRY+L+RE+  G DG +  +G  +R+N DLAN +
Sbjct: 297 KDGKMSKSKGNVVDPVTLIDRYGLDSLRYYLLREVPFGADGVFTPEGFVERINFDLANDL 356

Query: 359 GNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNL++R+V+M+ K +DG IP+   +  E    ++ V    ++   E M+N     AL +V
Sbjct: 357 GNLLNRTVAMMNKYFDGEIPSYSESKNEFSTQLVKVNHETVKGYEEAMENMEFSVALTKV 416

Query: 418 ISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
             L+S  ++Y D   PW L K     +  S V+Y   E +R+ A+LL+ F+ K   KIF+
Sbjct: 417 WQLISRTNKYIDETSPWALAKEEERKEELSEVMYHLAESLRRAAVLLKPFLTKTPGKIFE 476

Query: 476 ILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            L V DE+ + ++S+++   +  G  + K  +PIFPR 
Sbjct: 477 QLGVTDESLQSWESIERFDSIPSGTKVVKKGEPIFPRL 514


>gi|189425008|ref|YP_001952185.1| methionyl-tRNA synthetase [Geobacter lovleyi SZ]
 gi|189421267|gb|ACD95665.1| methionyl-tRNA synthetase [Geobacter lovleyi SZ]
          Length = 508

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/508 (43%), Positives = 329/508 (64%), Gaps = 8/508 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I Y N  PHIGHAY  + ADVLAR+ R+ G DV F TG+DEHGQK+ KAAQ
Sbjct: 2   KPSFYVTTPIYYVNDVPHIGHAYTTVAADVLARYKRMKGFDVFFLTGSDEHGQKVEKAAQ 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G T     D+  + F+ + + L IS++DFIRTT++RH      ++K++ ++GDIY G 
Sbjct: 62  TNGETPLELADRVVKRFQALWEKLGISHNDFIRTTQERHKQGVTHIFKQLMEQGDIYLGE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y  WY    E ++ + +V    DG+  +  + PV+ ++EE YFF++SAY +KLL++ E++
Sbjct: 122 YEDWYCTPCETFWTETQV---EDGKCPDC-NRPVEKLKEESYFFKMSAYGEKLLAHIEAN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+ISFVK GL+DLS+SR +F WGI +P + ++++YVW DALTNY++  G
Sbjct: 178 PDFIQPKTRRNEIISFVKEGLRDLSVSRTSFSWGIPVPGNERHVIYVWFDALTNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  N DG+  ++WPAD H+IGKDILRFH +YWP FL++A LP+P+KVF+HG+   +G+K+
Sbjct: 238 Y-PNADGNYGRYWPADAHLIGKDILRFHTVYWPTFLMAAGLPIPQKVFAHGWWTVEGQKM 296

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSL NV++P  +I++ GVD +RYFL+RE+  G DG +    L  R+N+DLAN +GNL+S
Sbjct: 297 SKSLQNVVEPNMLIDKYGVDVVRYFLLREVPFGLDGDFSHGSLINRINSDLANDLGNLLS 356

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS +M++K +DG++P PG  +E D ++ +    +L  +   M      +AL  +  ++S 
Sbjct: 357 RSTAMLVKYFDGILPAPGPLSELDATLKTKAEAMLAAVDNCMDELAFSKALQSIWDVISA 416

Query: 424 VDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K    R   +TV+Y  +E  R +  L+  F+P+ A K    L    
Sbjct: 417 GNKYIDETAPWGLAKDPAKREQLATVMYCLLEAQRLVHSLVAPFMPQTARKALACLGWQK 476

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
           E      +  +L PG ++ K    +FPR
Sbjct: 477 EATEEDLVWGKLAPGTIIEKA-AALFPR 503


>gi|308069627|ref|YP_003871232.1| Methionyl-tRNA synthetase (Methionine--tRNA ligase) [Paenibacillus
           polymyxa E681]
 gi|305858906|gb|ADM70694.1| Methionyl-tRNA synthetase (Methionine--tRNA ligase) [Paenibacillus
           polymyxa E681]
          Length = 672

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 229/524 (43%), Positives = 336/524 (64%), Gaps = 15/524 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M      YI+T I YP+ + HIGHAY  +  D +AR+ RL G +V + TGTDEHGQKI +
Sbjct: 1   MSNENTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYEVRYLTGTDEHGQKIEQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A  AG T + FVD      +++   LDIS DDFIRTTE+RH    + ++ ++  +GDIY
Sbjct: 61  KASAAGKTPQRFVDDIVAGIQELWRKLDISNDDFIRTTEERHKAVVQEIFDRLLKQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQ 173
           KG Y GWYS+ DE YY + +   V K A+G     +     +PV+ ++EE YFFR+S Y 
Sbjct: 121 KGEYEGWYSIPDETYYTETQLVDVVKDAEGNVAGGKSPDSGHPVELVKEECYFFRMSKYA 180

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL +YE +P+FI P  R+ E+I+ F+K GL+DL++SR TFDWGIK+  DP++++YVWI
Sbjct: 181 DRLLQFYEENPQFIQPESRKKEMINNFIKPGLEDLAVSRTTFDWGIKVKGDPKHVVYVWI 240

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL+NY+T  GY  +      KFWPA++H++GK+I+RFH IYWP  L++ +LPLPKKVF+
Sbjct: 241 DALSNYITALGYGSSNTELYDKFWPANVHIVGKEIVRFHTIYWPIMLMALDLPLPKKVFA 300

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG++L K  K+SKS GNV+DP+ +I+  G+D LRY+L+RE+  G DG +  +    RVN+
Sbjct: 301 HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDQLRYYLLREVPFGADGTFTPESFVDRVNS 360

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPTPGA-FTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNL++R+V+M+ K +DG +P   A  T  D ++  + +    ++ E M+N    
Sbjct: 361 DLANDLGNLLNRTVAMVDKYFDGKVPAYEANVTAFDGALEDMATSTYSKVEEAMENMEFS 420

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKL 469
            AL  +   +S  ++Y D  +PW L K    R   S+V+   VE +R  +ILLQ F+ + 
Sbjct: 421 VALTAISQFISRSNKYIDETQPWNLAKDEAKRRELSSVMLHLVESLRIASILLQPFLTRA 480

Query: 470 ANKIFDILFVAD-ENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
            +KI++ L ++  E   + S  Q  R+  G  L K  +PIFPR 
Sbjct: 481 PHKIWEQLGISQGELTTWDSGKQFGRIPEGTQLVKG-NPIFPRL 523


>gi|89892874|ref|YP_516361.1| hypothetical protein DSY0128 [Desulfitobacterium hafniense Y51]
 gi|89332322|dbj|BAE81917.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 647

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 330/512 (64%), Gaps = 14/512 (2%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I YPNA PHIG AY  + AD  AR+HRL G DV F TGTDE+ QKI + A++ 
Sbjct: 2   KYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFLTGTDENAQKIVRTAESQ 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+    +VD     F+ + + LDISYDDFIRTTE+RHH+  + ++ K+ ++GDIYK  Y 
Sbjct: 62  GMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVVKKIFTKLYEQGDIYKSEYE 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           GWY    E ++ ++++    DG+  N      V+ ++EE YFF+LS YQD LL + + HP
Sbjct: 122 GWYCTPCETFWTENKLI---DGKCPNPDCGRDVELLKEESYFFKLSKYQDALLRHIKDHP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNE+I F++ GL+DL +SR TF WGI++P +P++++YVW+DAL NY++  GY
Sbjct: 179 DFIQPASRRNEMIKFIEGGLEDLCVSRTTFQWGIQVPFNPKHVVYVWLDALINYISALGY 238

Query: 245 LDNPDGS-KAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK-GEK 302
              PDG    ++WPA++H++GKDI+RFHA+ WP  L++ ++PLPK V+ HG+ L K G K
Sbjct: 239 ---PDGELYQRYWPAEVHLMGKDIVRFHAVIWPIILMALDVPLPKVVYGHGWYLSKEGGK 295

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKS GNV D  ++I   G DA+RYFL+RE+  G DG Y +D L +R+N+DLAN +GN V
Sbjct: 296 ISKSRGNVQDSFKLIRRYGSDAIRYFLLREMQVGTDGAYSEDSLVERLNSDLANDLGNFV 355

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
           SRS++MI+K   G+IP  G  TE +  + ++   V+ ++ E ++      AL  +  LVS
Sbjct: 356 SRSLAMIVKYRGGVIPKAGEPTELEAELRALGQEVVAKVEERLEAHDPAGALENLWRLVS 415

Query: 423 EVDRYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
            +++Y D   PW L K     +R  TVL+   E IR L IL   F+PKL  K+F    ++
Sbjct: 416 RMNKYVDETAPWTLAKQEGQQERLDTVLHTFAEAIRVLGILCAPFMPKLTGKMFRQCGIS 475

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           DE   +++  +   L  G  + +  + +FPR 
Sbjct: 476 DELLAWEAAKEWDVLGEGIQVQRG-EALFPRI 506


>gi|260893945|ref|YP_003240042.1| methionyl-tRNA synthetase [Ammonifex degensii KC4]
 gi|260866086|gb|ACX53192.1| methionyl-tRNA synthetase [Ammonifex degensii KC4]
          Length = 512

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 227/513 (44%), Positives = 334/513 (65%), Gaps = 12/513 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R K YI+T I YP+ + HIGHAY  + AD +ARF R++G DV F TG DEHGQKI + A+
Sbjct: 2   RGKFYITTPIYYPSDRLHIGHAYTTVAADTVARFKRMEGYDVFFLTGADEHGQKIERTAK 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           + G   + +VD+   +F+++   L+ISYDDFIRTTE RH    + +++K+ ++GDIYK  
Sbjct: 62  SKGKDPQSYVDEIVASFKELWARLEISYDDFIRTTEPRHKVVAQKIFQKLYEQGDIYKST 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E ++   ++    DG+  +    PV+ ++EE YFFRLSAY D+LL+Y E H
Sbjct: 122 YQGWYCTPCETFWTARQL---VDGKCPDCG-RPVELLQEESYFFRLSAYADRLLAYIEEH 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNEVISF++ GL+DL +SR TF WGI +P DP++++YVWIDALTNYL+  G
Sbjct: 178 PDFIQPPARRNEVISFIRGGLEDLCVSRTTFSWGIPVPFDPRHVIYVWIDALTNYLSALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y    D    ++WPAD+H++GKDI+RFHAI WP+ L++  L LP++V  HG++L +G K+
Sbjct: 238 YGTEDDERFKRYWPADVHLVGKDIVRFHAIIWPSILMALGLELPRRVVGHGWLLVEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNVIDP  +I++ GVDA+RY+L+RE+A G DG Y++  L KR+N DLAN +GNL+ 
Sbjct: 298 SKSKGNVIDPHYLIDKYGVDAVRYYLLRELAFGADGEYEEKNLVKRLNYDLANDLGNLLY 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++++ K  +G+I  P      D+ ++++       + E +    +  ALA +  LV  
Sbjct: 358 RTLTVLEKYGEGVIGEPVEKEGPDDELIALAISTPARVAELVDQLQLSEALAAIWQLVGR 417

Query: 424 VDRYFDAQKPWELKKTNPDRAS---TVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
            ++Y D   PW L K +P R     TV+Y  +EV R + +LL  F+P    +++  L +A
Sbjct: 418 ANKYLDETAPWRLGK-DPGRKKRFDTVIYNVLEVYRFITVLLGPFMPGFPPRVWPQLGIA 476

Query: 481 D--ENRCFQSLD-QRLKPGFMLHKTFDPIFPRF 510
                  F+SL   +L PG  + K  +P+FPR 
Sbjct: 477 SLPALHTFESLKWGQLPPGIRVAKG-EPLFPRL 508


>gi|320529744|ref|ZP_08030822.1| methionyl-tRNA synthetase [Selenomonas artemidis F0399]
 gi|320137983|gb|EFW29887.1| methionyl-tRNA synthetase [Selenomonas artemidis F0399]
          Length = 514

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/492 (44%), Positives = 320/492 (65%), Gaps = 6/492 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   YI+T I YP+A+ HIGHAY   +AD +ARF RL G DV F TG+DEHGQKI +
Sbjct: 1   MSEKTPFYITTPIYYPSAKLHIGHAYCTTVADTIARFKRLAGYDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  GVT + +VD+    F+++  +L ISYDDFIRT+E+RHH+  + ++++I D+GDIY
Sbjct: 61  AAEKEGVTPQAYVDRIVAGFQELWQLLGISYDDFIRTSEERHHELVQNIFQQIYDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+   E+    +G   +  H PVQ + EE YFFR+S Y D++L+Y 
Sbjct: 121 KGEYKGLYCTPCESYWT--ELQLDENGNCPDC-HRPVQEVSEEAYFFRMSKYADRVLAYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           + HP+FI P+ RRNE+ISF++ GL+DL +SR +FDWGI +P DP++++YVW DALTNYLT
Sbjct: 178 KEHPDFIQPVSRRNEMISFIEQGLEDLCVSRTSFDWGIPVPFDPKHVVYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY+ + +  + K+WP D+H++GK+I+RFH I W   L++  L LPKKV+ HG+++  G
Sbjct: 238 PIGYMHDKETFR-KYWPCDVHLVGKEIVRFHTIIWGCMLMALGLALPKKVYGHGWLIVDG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DPI +IEE G DA+RYFL+REI  G+DG   +D L  R+N+DLAN +GN
Sbjct: 297 AKMSKSVGNVVDPIALIEEFGADAIRYFLLREITLGQDGNISRDALINRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R++SM  K   G+I      T  D S+  + +  ++     M+   +  A+  V + 
Sbjct: 357 LLHRTLSMAKKYRAGVIVKGTGETAFDASLEEMAAETVKMYTAQMEAMELSPAIRTVWAF 416

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           ++  ++Y D   PW L K      +   VLY  VE +   +IL+  F+P  A +I   L 
Sbjct: 417 IARTNKYIDETAPWTLAKDEAKAGQLDYVLYHLVEALHITSILIAPFMPVTARRIHAQLG 476

Query: 479 VADENRCFQSLD 490
            AD+    Q  D
Sbjct: 477 FADDFDAVQLAD 488


>gi|325294665|ref|YP_004281179.1| methionyl-tRNA synthetase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065113|gb|ADY73120.1| Methionyl-tRNA synthetase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 525

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/510 (45%), Positives = 323/510 (63%), Gaps = 10/510 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           EK Y++T I Y N  PH+GHAY    AD++ARF+R  G DV F TGTDEHGQKI +AA+ 
Sbjct: 2   EKFYVTTPIYYVNDIPHLGHAYTTTAADIVARFNRFLGRDVFFLTGTDEHGQKIQQAAEK 61

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+T K FVD     F+++ + L+ISYD FIRTT+  H    + ++KK  + GDIY G Y
Sbjct: 62  RGMTPKEFVDTLVPKFKELWEKLNISYDHFIRTTDPEHIKAVQYIFKKCYENGDIYLGEY 121

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY +  E Y+ + E+    +G+Y       V  ++EE YFFRLS YQD+LL +YE +P
Sbjct: 122 EGWYCIPCETYHTEKEL---LEGKYCPMCKREVVRVKEESYFFRLSKYQDRLLEFYEENP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEVI+FVK GLKDLS+SR +F WGI +P + ++++YVW DALTNYLT  GY
Sbjct: 179 DFIAPEFRRNEVINFVKQGLKDLSISRTSFTWGIPVPINEKHVIYVWFDALTNYLTAVGY 238

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            DN D     +WPADLH++GKDILRFH +YWPAFL+SA L +PK+VF+HG+    GEK+S
Sbjct: 239 PDNMDKVN-HYWPADLHLVGKDILRFHTVYWPAFLMSAGLEIPKRVFAHGWWTVNGEKMS 297

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KS GNV +P E+IE+ GVD +R+FL RE++ G DG +  + L  R+N +LAN +GNL +R
Sbjct: 298 KSKGNVANPFEIIEKFGVDQVRFFLFREVSFGLDGDFTYEKLVGRINGELANDLGNLFNR 357

Query: 365 SVSMILKDYDGMIPTP-GAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           ++SM+ K    ++P P GA  E D  + +        ++E +    + RAL ++   VS 
Sbjct: 358 TLSMLKKYRKSIVPEPKGAEDELDVELKNKAIATAARLKELIPKAELTRALEEIWQFVSF 417

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           V+ Y D + PW L K   +    VLY  VE +R +   +  ++P  A K+ ++L +  + 
Sbjct: 418 VNFYIDRRAPWSLNKEGKEELDRVLYNMVEALRFITAFVYPYMPSSAEKMAEMLKLGKKA 477

Query: 484 RCFQSLDQR----LKPGFMLHKTFDPIFPR 509
              +  +      +KPG  L K    +FPR
Sbjct: 478 ESLRISEFEDWGGIKPGTELEKG-GILFPR 506


>gi|219666137|ref|YP_002456572.1| methionyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2]
 gi|219536397|gb|ACL18136.1| methionyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2]
          Length = 647

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 329/512 (64%), Gaps = 14/512 (2%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I YPNA PHIG AY  + AD  AR+HRL G DV F TGTDE+ QKI + A++ 
Sbjct: 2   KYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFLTGTDENAQKIVRTAESQ 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+    +VD     F+ + + LDISYDDFIRTTE+RHH+  + ++ K+ ++GDIYK  Y 
Sbjct: 62  GMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVVKKIFTKLYEQGDIYKSEYE 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           GWY    E ++ ++++    DG+  N      V+ ++EE YFF+LS YQD LL + + HP
Sbjct: 122 GWYCTPCETFWTENKLM---DGKCPNPDCGRDVELLKEESYFFKLSKYQDALLRHIKDHP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNE+I F++ GL+DL +SR TF WGI++P +P++++YVW+DAL NY++  GY
Sbjct: 179 DFIQPASRRNEMIKFIEGGLEDLCVSRTTFQWGIQVPFNPKHVVYVWLDALINYISALGY 238

Query: 245 LDNPDGS-KAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK-GEK 302
              PDG    ++WPA++H++GKDI+RFHA+ WP  L++ ++PLPK V+ HG+ L K G K
Sbjct: 239 ---PDGELYQRYWPAEVHLMGKDIVRFHAVIWPIILMALDVPLPKVVYGHGWYLSKEGGK 295

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKS GNV D  E+I   G DA+RYFL+RE+  G DG Y +D L +R+N+DLAN +GN V
Sbjct: 296 ISKSRGNVQDSFELIRRYGSDAIRYFLLREMQVGTDGAYSEDSLVERLNSDLANDLGNFV 355

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
           SRS++MI+K   G+IP     TE +  + ++   V+ ++ E ++      AL  +  LVS
Sbjct: 356 SRSLAMIVKYRGGVIPKAAEPTELEAELRALGQEVVAKVEERLEAHDPAGALENLWRLVS 415

Query: 423 EVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
            +++Y D   PW L K    +A   TVL+   E IR L IL   F+PKL  K+F    ++
Sbjct: 416 RMNKYVDETAPWTLAKQEGQQARLDTVLHTFAEAIRILGILCAPFMPKLTGKMFRQCGIS 475

Query: 481 DENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           DE   +++  +   L  G  + +  + +FPR 
Sbjct: 476 DELLAWEAAKEWAVLGEGIQVQRG-EALFPRI 506


>gi|148265184|ref|YP_001231890.1| methionyl-tRNA synthetase [Geobacter uraniireducens Rf4]
 gi|146398684|gb|ABQ27317.1| methionyl-tRNA synthetase [Geobacter uraniireducens Rf4]
          Length = 509

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 227/510 (44%), Positives = 325/510 (63%), Gaps = 18/510 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  + ADVLAR+ RL G +V F TGTDEHGQK+ KAA  AG
Sbjct: 5   FYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFEVFFLTGTDEHGQKVEKAANAAG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T +   D+  + F+ + + LDISY DFIRTT++RH      L+ K+  KGDIY G Y  
Sbjct: 65  ETPQELADRVMKRFQALWEKLDISYTDFIRTTQERHKKGVADLFTKVMGKGDIYLGEYED 124

Query: 127 WYSLRDEAYYNDDEV--YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           WY    E ++ + ++  YK  D       + P + ++EE YFFR+S YQ++LL++ E++P
Sbjct: 125 WYCTPCETFWTETQLIDYKCPDC------NRPTEKLKEESYFFRMSKYQEQLLAHIEANP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNE+ISFV+ GL+DLS+SR TF WGI +P + ++++YVW DALTNY+T  GY
Sbjct: 179 DFIQPKSRRNEIISFVREGLRDLSVSRTTFTWGIPVPGNDKHVIYVWFDALTNYITALGY 238

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D   G+ +KFWP D H+IGKDILRFHA+YWP FL++A LP+PKKVF+HG+   +G+K+S
Sbjct: 239 PDE-SGNFSKFWPVDAHLIGKDILRFHAVYWPTFLMAAGLPVPKKVFAHGWWTVEGQKMS 297

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSL NV++P  +I++ GVDA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL++R
Sbjct: 298 KSLQNVVEPNMLIDKYGVDAIRYFLLREVPFGLDGDFSHTALVHRINSDLANDLGNLLNR 357

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S +M+ K + G++  PG F E D         +++++  ++      +AL  +  +VS  
Sbjct: 358 STAMVNKYFGGVVQAPGVFNEIDSIYREKTEEMVRQVDAHLDELAFSKALQSIWEVVSAG 417

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF---V 479
           ++Y D   PW L K     DR +TV+Y  +E  R +  ++ AF+P+   K    L     
Sbjct: 418 NKYIDETAPWTLAKDEAQKDRLATVMYCLLESQRIVYFIISAFMPQTTVKGLGYLGWNEA 477

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
            DEN         LKPG  + K  + +FPR
Sbjct: 478 PDENGLRWG---GLKPGTQVIKA-EALFPR 503


>gi|257439196|ref|ZP_05614951.1| methionine--tRNA ligase [Faecalibacterium prausnitzii A2-165]
 gi|257198329|gb|EEU96613.1| methionine--tRNA ligase [Faecalibacterium prausnitzii A2-165]
          Length = 666

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/516 (41%), Positives = 323/516 (62%), Gaps = 15/516 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E    YI+T I YP+ + HIGH+Y  +  D LARF R+ G +V+F TGTDEHGQKI  
Sbjct: 1   MSEHNTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGKEVMFLTGTDEHGQKIQD 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A +AGVT K +VD+     +D+  +LD+SYD FIRTT+  H +TC+ ++ ++ ++GDIY
Sbjct: 61  KAADAGVTPKEYVDRIVATVKDLWKLLDVSYDRFIRTTDDYHVETCQKIFTQLYEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKG----ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           KG Y G Y    E+++ D ++  G       + Y+A         EE YFF+   Y D+L
Sbjct: 121 KGEYIGHYCKPCESFWTDSQLVDGKCPDCGREVYDAH--------EEAYFFKTGKYADRL 172

Query: 177 LSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALT 236
           L YYE +P+FI P  R+NE+I+F+K GL+D  +SR +  WGI +P DP++ MYVW+DAL+
Sbjct: 173 LKYYEENPQFIQPESRKNEMIAFIKQGLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALS 232

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY++  GY +       KFWPADLH++GK+ILRFH I WPA L++ +LPLPK+VF HG++
Sbjct: 233 NYISALGYGNETYHDYNKFWPADLHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWL 292

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L  G K+SKS+GNV+DP+ + +  GVD++RYFL+REI  G DG +  + L  R+N+DLAN
Sbjct: 293 LMNGGKMSKSVGNVVDPVVLCDRYGVDSIRYFLLREIPFGNDGMFTNEALINRINSDLAN 352

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL+SR+V+M  K + G +         D  + ++ + +L ++  +M N  I +AL +
Sbjct: 353 DLGNLLSRTVAMCEKYFGGTVHKAAGTEAIDTELETMVNELLGKVTADMDNLTIPQALME 412

Query: 417 VISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           + +++   ++Y D   PW L K   N  R  +VLY   E +R   ILL A++P  A K+ 
Sbjct: 413 IFAVIQRANKYIDETAPWALAKDEANKARLESVLYHLCEALRVAGILLNAYLPSTAPKMM 472

Query: 475 DILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           D L ++  +         ++  + +HK  D +FPR 
Sbjct: 473 DQLGLSTADIDLSKAAYGVQETYTVHKG-DALFPRI 507


>gi|296131644|ref|YP_003638891.1| methionyl-tRNA synthetase [Thermincola sp. JR]
 gi|296030222|gb|ADG80990.1| methionyl-tRNA synthetase [Thermincola potens JR]
          Length = 647

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/512 (41%), Positives = 330/512 (64%), Gaps = 9/512 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+   HIGHAY  + AD +AR+ R+ G DV F TG+DEHGQKI + A+
Sbjct: 2   KKTFYITTPIYYPSDNLHIGHAYTTVAADTIARYKRMTGYDVRFLTGSDEHGQKIERTAK 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GV    +VD+    F+++   LD+ YDDFIRTTE RH +  + ++ ++ ++GDIYK  
Sbjct: 62  ARGVEPIDYVDRIVAGFKNLWRHLDVHYDDFIRTTEPRHKEVVQKIFTRLYEQGDIYKSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E ++ + +  +G           PV+ + EE YFFR+S Y D+LL Y E +
Sbjct: 122 YEGLYCTPCETFWTERQAEEGNCPDC----GRPVERVREESYFFRMSKYADRLLRYIEEN 177

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P+ RRNE+++F+K GL+DL +SR TFDWGIK+P DP++++YVW+DALTNY++  G
Sbjct: 178 PDFIQPVSRRNEMVNFIKQGLEDLCVSRTTFDWGIKVPFDPKHVVYVWVDALTNYISALG 237

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y    D    K+WPAD+H++GKDI+RFH I WP  L++   PLPKKV  HG++L +G K+
Sbjct: 238 YGTENDELYKKYWPADVHLVGKDIVRFHTIIWPILLMAIGEPLPKKVMGHGWLLLEGGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNVIDP+ +I++ GVDA+RY+L+RE+  G DG+Y ++ L +R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNVIDPLVLIDKYGVDAIRYYLLRELPFGSDGYYAEEALIQRINSDLANDLGNLIS 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++M+ K ++GM+  P    E DE +  +    +++ R  M+   +  ALA +  L+  
Sbjct: 358 RTIAMVEKYFNGMVQAPTEKEEIDEDLRQLAMVTVEDYRNQMEKLELSNALASIWKLIGR 417

Query: 424 VDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K    R    TVLY  +EVIR + +L+  F+ +L +K++    ++ 
Sbjct: 418 ANKYIDETAPWILAKDEAKRPRLGTVLYNLLEVIRIVTVLVSPFMTRLPDKVWVQCGLSG 477

Query: 482 ENRC--FQSLDQRLK-PGFMLHKTFDPIFPRF 510
           +  C  ++S+    + P  +  K  + +FPR 
Sbjct: 478 KEECTTWESVQNWGRFPADINVKRGEALFPRI 509


>gi|297616267|ref|YP_003701426.1| methionyl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144104|gb|ADI00861.1| methionyl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
          Length = 646

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/475 (44%), Positives = 315/475 (66%), Gaps = 7/475 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M + +  YI+T I YP+   HIGHAY  + AD +AR+ R+ G DV F TG+DEHGQKI +
Sbjct: 1   MGDGKSFYITTPIYYPSDNLHIGHAYTTVAADCIARYKRMQGYDVFFLTGSDEHGQKIER 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A++ G+  K +VD+    F+ + D L IS++DFIRTTE+RH    + +++K+ +KGDIY
Sbjct: 61  TARDKGMEPKAYVDRIVDGFKVLWDTLLISHNDFIRTTEERHEKAVQTIFQKVYEKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y GWY    EA++ + ++    DG+  +    PV+  +EE YFF +S Y ++LL + 
Sbjct: 121 KAKYEGWYCTPCEAFWTERQL---VDGKCPDCDR-PVELTQEESYFFAMSKYAERLLKHI 176

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P  RRNE+I+F+KSGL+DL +SR TF+WGI IP  P +++YVW DAL NYLT
Sbjct: 177 EENPDFIQPESRRNEMINFIKSGLEDLCVSRTTFEWGIPIPFAPGHVIYVWFDALVNYLT 236

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY D+ +    K+WPAD+H++GKDI+RFH + WP  L++A+LPLPK+VF HG+++ +G
Sbjct: 237 AVGYPDDQE-KFGKYWPADVHLVGKDIVRFHTVIWPTILMAADLPLPKQVFGHGWLMLEG 295

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS GNV+DP+ ++E+ GVD++RY+L++E+  G DG+Y ++ L  R+N+DLAN +GN
Sbjct: 296 GKMSKSKGNVVDPLILVEKYGVDSIRYYLLKELNYGMDGYYSEEMLIARINSDLANDLGN 355

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           LVSR++ MI +   G+IP PG     D+ ++   + V  E+   +       AL  V  L
Sbjct: 356 LVSRTIGMIERYCQGVIPVPGPQEGLDQELVDTAAAVYGEVGRQLDRLDFSSALGAVWRL 415

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +S  ++Y D   PW L +     +R +TVLY   EVIR   I+L  F+P L  +I
Sbjct: 416 ISRANKYIDESAPWLLARDEAKRERLNTVLYNLAEVIRITGIMLAPFMPTLPGRI 470


>gi|322420739|ref|YP_004199962.1| methionyl-tRNA synthetase [Geobacter sp. M18]
 gi|320127126|gb|ADW14686.1| methionyl-tRNA synthetase [Geobacter sp. M18]
          Length = 509

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/510 (43%), Positives = 327/510 (64%), Gaps = 12/510 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I Y N  PHIGHAY  + ADVLAR+ RL G DV F TGTDEHGQK+ KAA 
Sbjct: 2   KPAFYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLMGFDVFFLTGTDEHGQKVEKAAN 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T     D+  + F+ + + L+IS+ DFIRTT++RH     +L+ ++  KGDIY G 
Sbjct: 62  AAGETPLELADRVMKRFQSLWEKLEISHTDFIRTTQERHKKGVSVLFDRVMAKGDIYLGE 121

Query: 124 YSGWYSLRDEAYYNDDEV--YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           Y  WY    E ++ + ++  YK  D       + P + ++EE YFFR+S YQD+LL++ E
Sbjct: 122 YEDWYCTPCETFWTETQLIDYKCPDC------NRPTEKLKEESYFFRMSKYQDQLLAHIE 175

Query: 182 SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           ++P+FI P  RRNE+ISFVK GL+DLS+SR TF+WGI +P + ++++YVW DALTNY+T 
Sbjct: 176 ANPDFIQPKSRRNEIISFVKEGLRDLSVSRTTFEWGIPVPGNDKHVIYVWFDALTNYITA 235

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
            GY D  +G+  K+WP D+H+IGKDILRFH +YWP FL++A LP+PK+VF+HG+   +G+
Sbjct: 236 LGYPDE-EGNFGKYWPCDVHLIGKDILRFHTVYWPTFLMAAGLPIPKRVFAHGWWTVEGQ 294

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKSL NV++P  ++++ GVDA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL
Sbjct: 295 KMSKSLQNVVEPNMLVDKYGVDAVRYFLLREVPFGLDGDFSHQALIHRINSDLANDLGNL 354

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           ++RS +M+ K + G +  PG  +E D++       ++ ++   +++    RAL  +  ++
Sbjct: 355 LNRSTAMLGKYFGGELQAPGEESELDKAYREKTLAMIGQVDGFIEDMAFSRALQAIWEVI 414

Query: 422 SEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K     +R STV+Y  +E  R +  LL AF+PK A K    L  
Sbjct: 415 SAGNKYIDETAPWTLAKDPEQRERLSTVMYYMLESQRIVYTLLSAFMPKTAEKGLSYLGW 474

Query: 480 ADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
            +           LKPG  + K  + +FPR
Sbjct: 475 PEAASAEGLAWGGLKPGTAIAKA-EALFPR 503


>gi|325845442|ref|ZP_08168735.1| methionine--tRNA ligase [Turicibacter sp. HGF1]
 gi|325488548|gb|EGC90964.1| methionine--tRNA ligase [Turicibacter sp. HGF1]
          Length = 655

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/514 (42%), Positives = 337/514 (65%), Gaps = 11/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I YP+ + HIG AY  + +D +AR+ R  G DV F TG DEHGQKI + AQ
Sbjct: 3   KPTFYITTPIYYPSGKFHIGTAYTTVASDAMARYKRSRGFDVRFLTGMDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG   + +VD+ +   + + +++DI+ DDFIRTTEKRH +    ++ K  + GDIYKG 
Sbjct: 63  EAGKEPQAYVDEIADAAKKLWEMMDITNDDFIRTTEKRHEEMVEKIFAKFMENGDIYKGH 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+YY + ++    DG+  +   + V+ ++EE YFF +  Y D+L+ YY ++
Sbjct: 123 YEGLYCTPCESYYTETQL---VDGKCPDCGRD-VKVVKEESYFFNMKKYADRLMEYYNAN 178

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           PEFILP  R+NE+++ F+K GL+DLS+SR TFDWG+K+P D ++++YVW+DAL+NY+T  
Sbjct: 179 PEFILPESRKNEMVNNFIKPGLEDLSVSRTTFDWGVKVPGDIKHVIYVWVDALSNYITAL 238

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY  + +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKK+F+HGFI+ K  K
Sbjct: 239 GYGSDNEELFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKIFAHGFIMMKDGK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+ P  +IE  G+DA+RYFL+RE+  G+DG +  +   +RVN DLAN +GNL+
Sbjct: 299 MSKSKGNVVYPEMLIERYGLDAVRYFLLRELPFGQDGVFSPESFVERVNFDLANDLGNLL 358

Query: 363 SRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +R+VSMI K +DG+IP   G  TE D+++       ++++ +N ++      L+ + +LV
Sbjct: 359 NRTVSMINKYFDGVIPAYAGQVTEFDQTLEDFIKTTVEKVEKNFEDMQFSIVLSDIWALV 418

Query: 422 SEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L K   ++A+  +V+    E +RQ+AI+++ F+P+   +IF  L +
Sbjct: 419 ARTNKYIDETAPWVLAKDEANKAALESVMCHLAESLRQIAIMIEPFMPRTTPQIFAQLGI 478

Query: 480 -ADENRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
               ++ + SL+    L  G  +     PIFPR 
Sbjct: 479 EGAASKEWSSLNNYNTLAEGTKVVSKGTPIFPRL 512


>gi|158321682|ref|YP_001514189.1| methionyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs]
 gi|158141881|gb|ABW20193.1| methionyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs]
          Length = 654

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/510 (42%), Positives = 326/510 (63%), Gaps = 10/510 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I YP+ + HIGH Y  + ADVLARF R  G DV F TGTDEHG+KI +AA+ AG
Sbjct: 6   FYLTTPIYYPSGRLHIGHTYTTVAADVLARFKRFTGYDVQFLTGTDEHGEKIQEAAEKAG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           V+ K ++D+     +D+   +DISYD FIRTT++ H +  + +++ + DKGDIYK  Y G
Sbjct: 66  VSPKEYLDKIVEEIKDLWKKMDISYDIFIRTTDQEHEERVQKIFQTLYDKGDIYKSEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E+++ + ++    +G      + P    +EE YFF+LS YQD+LL Y+E HPE 
Sbjct: 126 WYCTPCESFWTETQL---KEGHVCPDCNRPAHLAKEEAYFFKLSKYQDRLLQYFEEHPEI 182

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
             P  R+NE+++ F+K GL+DL +SR TFDWGIK+P DP++I+YVW DA+ NY+T  GY 
Sbjct: 183 CYPESRKNEMVNNFLKPGLEDLCVSRTTFDWGIKVPFDPKHIIYVWFDAVCNYITALGYG 242

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            + + +  K+WPAD+H++GK+I+RFH I WPA L++  +PLPK V+ HG+IL   +K+SK
Sbjct: 243 SDNEETFNKYWPADVHLVGKEIVRFHTIIWPAILMALEIPLPKMVYGHGWILFGADKMSK 302

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GN++ P  +IE  G+DA++YFL+RE   G+DG +       R+N+DLAN +GNLVSR+
Sbjct: 303 SKGNIVYPEPLIERYGLDAIKYFLLREFTFGQDGNHTNRNFINRLNSDLANDLGNLVSRT 362

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           VSMI K  +G+IP+PG   E D S+  + +    ++   +     H  L ++  +V + +
Sbjct: 363 VSMIEKYNEGIIPSPGVEGEFDGSLKEIATGAASKVENAINKLQFHDGLEEIWKVVRKTN 422

Query: 426 RYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFD-ILFVADE 482
           +Y D   PW L K   N +R +TVLY   E IR +++L++ F+    NKI+  +    D+
Sbjct: 423 KYIDETAPWVLAKDEANKERLNTVLYNLAEAIRIISVLIKPFMESTTNKIWSQVGITEDQ 482

Query: 483 NRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
              ++S     +LK G  + K  + +FPR 
Sbjct: 483 GTDWESTGTFGKLKAGTAVKKG-EALFPRL 511


>gi|295102779|emb|CBL00324.1| methionyl-tRNA synthetase [Faecalibacterium prausnitzii L2-6]
          Length = 665

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/516 (41%), Positives = 324/516 (62%), Gaps = 15/516 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E +  YI+T I YP+ + HIGH+Y  +  D LARF R+ G DV+F TGTDEHGQKI  
Sbjct: 1   MSEHKTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGCDVMFLTGTDEHGQKIQD 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A +AGVT K +VD+     +D+  ++DISYD FIRTT+  H ++C+ ++ K+ ++GDIY
Sbjct: 61  KAADAGVTPKEYVDKIVATVKDLWKLMDISYDRFIRTTDDYHMESCQKIFTKLYEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKG----ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           KG Y+G Y    E+++ D ++  G       + Y+A         EE YFF+   Y D+L
Sbjct: 121 KGEYTGHYCKPCESFWTDSQLVDGKCPECGREVYDAH--------EEAYFFKTGKYADRL 172

Query: 177 LSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALT 236
           L  YE +P+FI P  R+NE+I+F+K GL+D  +SR +  WGI +P DP++ MYVW+DAL+
Sbjct: 173 LKLYEENPQFIQPESRKNEMIAFIKQGLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALS 232

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY++  GY +      +KFWPADLH++GK+ILRFH I WPA L++ +LPLPK+VF HG++
Sbjct: 233 NYISALGYGNEKYDEYSKFWPADLHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWL 292

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L  G K+SKS+GNV+DP+ + +  GVDA+RYFL+REI  G DG +  + L  R+N+DLAN
Sbjct: 293 LMNGGKMSKSVGNVVDPVILCDRYGVDAIRYFLLREIPFGNDGMFTNEALINRINSDLAN 352

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL+SR+V+M  K + G +         D  + ++ S +L ++  +M +  I +AL +
Sbjct: 353 DLGNLLSRTVAMCEKYFGGTVHKVAGTEAIDTELETMTSELLGKVTADMDSLTIPQALME 412

Query: 417 VISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           + +++   ++Y D   PW L K   +RA   +VLY   E +R   ILL A++P  A K+ 
Sbjct: 413 IFAVIQRANKYIDETAPWALAKDEANRARLESVLYHLCEALRVCGILLNAYLPSTAPKMM 472

Query: 475 DILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           + L +       +      +  + +HK  + +FPR 
Sbjct: 473 EQLGLDASAIDVEKAAYGAQESYTVHKG-EALFPRI 507


>gi|293374654|ref|ZP_06620969.1| methionine--tRNA ligase [Turicibacter sanguinis PC909]
 gi|292646744|gb|EFF64739.1| methionine--tRNA ligase [Turicibacter sanguinis PC909]
          Length = 655

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/514 (42%), Positives = 337/514 (65%), Gaps = 11/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   YI+T I YP+ + HIG AY  + +D +AR+ R  G DV F TG DEHGQKI + AQ
Sbjct: 3   KPTFYITTPIYYPSGKFHIGTAYTTVASDAMARYKRSRGFDVHFLTGMDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG   + +VD+ +   + + +++DI+ DDFIRTTEKRH +    ++ K  + GDIYKG 
Sbjct: 63  EAGKEPQAYVDEIADAAKKLWEMMDITNDDFIRTTEKRHEEMVEKIFAKFMENGDIYKGH 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+YY + ++    DG+  +   + V+ ++EE YFF +  Y D+L+ YY ++
Sbjct: 123 YEGLYCTPCESYYTETQL---VDGKCPDCGRD-VKVVKEESYFFNMKKYADRLMEYYNAN 178

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           PEFILP  R+NE+++ F+K GL+DLS+SR TFDWG+K+P D ++++YVW+DAL+NY+T  
Sbjct: 179 PEFILPESRKNEMVNNFIKPGLEDLSVSRTTFDWGVKVPGDIKHVIYVWVDALSNYITAL 238

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY  + +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKK+F+HGFI+ K  K
Sbjct: 239 GYGSDNEELFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKIFAHGFIMMKDGK 298

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+ P  +IE  G+DA+RYFL+RE+  G+DG +  +   +RVN DLAN +GNL+
Sbjct: 299 MSKSKGNVVYPEMLIERYGLDAVRYFLLRELPFGQDGVFSPESFVERVNFDLANDLGNLL 358

Query: 363 SRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           +R+VSMI K +DG+IP   G  TE D+++       ++++ +N ++      L+ + +LV
Sbjct: 359 NRTVSMINKYFDGVIPAYAGQVTEFDQTLEDFIKTTVEKVEKNFEDMQFSIVLSDIWALV 418

Query: 422 SEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +  ++Y D   PW L K   ++A+  +V+    E +RQ+AI+++ F+P+   +IF  L +
Sbjct: 419 ARTNKYIDETAPWVLAKDEANKAALESVMCHLAESLRQIAIMIEPFMPRTTPQIFAQLGI 478

Query: 480 -ADENRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
               ++ + SL+    L  G  +     PIFPR 
Sbjct: 479 EGAASKEWNSLNNYNTLAEGTKVVSKGTPIFPRL 512


>gi|39997330|ref|NP_953281.1| methionyl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|39984221|gb|AAR35608.1| methionyl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|298506267|gb|ADI84990.1| methionyl-tRNA synthetase [Geobacter sulfurreducens KN400]
          Length = 510

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/505 (43%), Positives = 323/505 (63%), Gaps = 8/505 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  + ADVLAR+ +L G +V F TGTDEHGQK+ KAA  AG
Sbjct: 5   FYVTTPIYYVNDVPHIGHAYTTLAADVLARYKKLKGYEVFFLTGTDEHGQKVEKAANTAG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T     D+  + F+ + + LDI Y DFIRTT++RH      ++ KI  +GDIY G Y  
Sbjct: 65  ETPLELADRVVKRFQGLWEKLDIQYTDFIRTTQERHKKGVSHIFTKIMAQGDIYLGEYED 124

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E ++ + ++    DG+  +  + PV  ++EE YFFR+S YQ++LL++ E++P+F
Sbjct: 125 WYCTPCETFWTETQL---IDGKCPDC-NRPVDKLKEESYFFRMSKYQEQLLAHIEANPDF 180

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE+ISFVK GL+DLS+SR +F+WGI +P + ++++YVW DALTNY+T  GY D
Sbjct: 181 IQPKSRRNEIISFVKEGLRDLSVSRTSFNWGIPVPGNEKHVIYVWFDALTNYITALGYPD 240

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
                K  FWP D+H+IGKDILRFHA+YWP FL++A LP+PKKVF+HG+   +G+K+SKS
Sbjct: 241 EQSAFKT-FWPVDVHLIGKDILRFHAVYWPTFLMAAGLPVPKKVFAHGWWTVEGQKMSKS 299

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           L NV++P  +++  G+DA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL++RS 
Sbjct: 300 LQNVVEPNMLVDRYGIDAVRYFLLREVPFGLDGDFSHAALVHRINSDLANDLGNLLNRST 359

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +M+ K +DG++P PG  TE D +       +++++   M      + L  +  ++S  ++
Sbjct: 360 AMVNKYFDGVLPAPGPQTELDTAFREKTEAMVRQLDACMDELAFSKGLQAIWEVISAGNK 419

Query: 427 YFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           Y D   PW L K    R    TV+Y  +E  R + ++L AF+P+ + K    L   +  R
Sbjct: 420 YIDETAPWALAKDPAKREYLGTVMYTLLEAQRIVHLVLSAFMPRTSAKALGYLGWTEPCR 479

Query: 485 CFQSLDQRLKPGFMLHKTFDPIFPR 509
                  RL PG ++ K  + +FPR
Sbjct: 480 EEDLAWGRLAPGTLIVKA-EALFPR 503


>gi|290967766|ref|ZP_06559319.1| methionine--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
 gi|290782125|gb|EFD94700.1| methionine--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
          Length = 645

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/476 (44%), Positives = 310/476 (65%), Gaps = 5/476 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+++ YI+T I YP+A+ HIGH Y   IAD LARFHRL G +V F TG+DEHGQKI +
Sbjct: 1   MAEKKRYYITTPIYYPSAKLHIGHTYCTTIADTLARFHRLRGDEVFFLTGSDEHGQKIQR 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+    +V+     F+D+   L IS DDFIRTTE RH    + L +    KGDIY
Sbjct: 61  AAEEKGIQPIEYVNDIVALFQDLWKRLQISNDDFIRTTEARHEKVVQKLMEISYQKGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y+GWY    E+++ ++++ +G           P++ ++EE YF +++ Y D+ L + 
Sbjct: 121 KGEYTGWYCTPCESFWPENKLPEGK--HICPDCGRPLELVKEEAYFLKMNKYADRWLQFI 178

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +PEFI P  RRNE+I+FVKSGL+DL +SR +FDWG+K+P DP++++YVW DAL NYLT
Sbjct: 179 EENPEFIQPESRRNEMIAFVKSGLEDLCVSRTSFDWGVKVPWDPKHVVYVWFDALANYLT 238

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYLDNP+  K KFWPA LH++GK+I+RFH I WP  L+S +LPLPK+VF HG+++  G
Sbjct: 239 AIGYLDNPEQFK-KFWPATLHLVGKEIVRFHTIIWPIILMSCDLPLPKQVFGHGWLIVDG 297

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKSLGNV+DP+ +I   G DALRY+L++EI  G+DG +       R+N+DLAN +GN
Sbjct: 298 TKMSKSLGNVVDPVPLIARYGADALRYYLLKEIRLGQDGNFSLPSFLGRINSDLANDLGN 357

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R+++M+ K   G++P P A    D  +    + +L    + M+   I+ A+  +   
Sbjct: 358 LLQRTLAMVEKYEQGIVPAPSATAPVDMQLRQAAAEMLDVYTQAMETMQINEAINALWGF 417

Query: 421 VSEVDRYFDAQKPWELKKTNP--DRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           +   ++Y D   PW L K +   +R  TVLY  +E +R +AI +   +P  A +I+
Sbjct: 418 IHRTNKYIDETMPWSLAKEDAQRERLRTVLYNLIEALRIIAISVSPIMPACAEEIW 473


>gi|304438288|ref|ZP_07398229.1| methionine--tRNA ligase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368654|gb|EFM22338.1| methionine--tRNA ligase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 516

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/484 (45%), Positives = 323/484 (66%), Gaps = 7/484 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+   YI+T I YP+A+ HIGHAY   +AD +AR+ RL G DV F TG+DEHGQKI +
Sbjct: 1   MSEKTPFYITTPIYYPSAKLHIGHAYCTTVADTIARYKRLAGFDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+T   +VD+   +F+++  +L ISYDDFIRTT+ RH++  + ++++I D+GDIY
Sbjct: 61  AAEKEGITPIRYVDRIVASFQELWRLLGISYDDFIRTTQPRHYELVQDIFQRIYDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+   ++    +G   +  H PVQ + EE YFFR+S Y D+LL+Y 
Sbjct: 121 KGEYKGLYCTPCESYWTRLQL--DENGCCPDC-HRPVQEVSEEAYFFRMSKYADRLLAYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
             HP+FI P+ RRNE+I+F++ GL+DL +SR +FDWGI +P DP++++YVW DALTNYLT
Sbjct: 178 NEHPDFIQPVSRRNEMIAFIEQGLEDLCVSRTSFDWGIPVPFDPKHVVYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYL + +    K+WPAD+H++GK+I+RFH I W   L++  L LPKKV+ HG+++  G
Sbjct: 238 PIGYLHDKEMFH-KYWPADVHLVGKEIVRFHTIIWGCMLMALGLDLPKKVYGHGWLIVNG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DP+ +IEE G DA+RYFL+REIA G+DG   +D L  R+N+DLAN +GN
Sbjct: 297 AKMSKSVGNVVDPVALIEEFGADAIRYFLLREIALGQDGNISRDALIGRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R++SM  K   G+I      T+ D ++ ++ +  +++  E M    +  A+  V +L
Sbjct: 357 LLHRTLSMAKKYRKGVITKGEGRTDFDAALETMTAATVRDYTEQMDAMELSAAVKTVWAL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKIFDIL- 477
           +S  ++Y D   PW L K     A    VLY  VE +  +++L+  F+P  A +I + L 
Sbjct: 417 ISRTNKYIDETAPWMLAKDEAKAAQLDAVLYHLVETLHIVSVLIAPFMPTTARRIHEQLG 476

Query: 478 FVAD 481
           F AD
Sbjct: 477 FHAD 480


>gi|292670061|ref|ZP_06603487.1| methionine-tRNA ligase [Selenomonas noxia ATCC 43541]
 gi|292648249|gb|EFF66221.1| methionine-tRNA ligase [Selenomonas noxia ATCC 43541]
          Length = 513

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/513 (43%), Positives = 325/513 (63%), Gaps = 8/513 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +   YI+T I YP+A+ HIGHAY   +AD +ARF RL G DV F TG+DEHGQKI +
Sbjct: 1   MSGKTPFYITTPIYYPSAKLHIGHAYCTTVADTIARFKRLAGCDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  GVT   +VD+    F+++  +L ISYDDFIRT+E RH++  + ++++I D+GDIY
Sbjct: 61  AAEKEGVTPLQYVDRIVAGFQELWRLLGISYDDFIRTSEPRHYELVQNIFQQIYDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+   ++    +G   +  H PVQ + EE YFFR+S Y D+L++Y 
Sbjct: 121 KGAYKGLYCTPCESYWTKLQL--DENGCCPDC-HRPVQEVAEEAYFFRMSKYADRLIAYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
             HP+FI P+ RRNE+I+F++ GL+DL +SR +FDWGI +P DP++++YVW DALTNYLT
Sbjct: 178 NEHPDFIQPVSRRNEMIAFIEQGLEDLCVSRTSFDWGIPVPFDPKHVVYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYL + +   +K+WPAD+H++GK+I+RFH I W   L++  L LPKKV+ HG+++  G
Sbjct: 238 PIGYLHDKE-KFSKYWPADVHLVGKEIVRFHTIIWGCMLMALGLDLPKKVYGHGWLIVDG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DPI +IEE G DA+RYFL+REI  G+DG   +D L  R+N+DLAN +GN
Sbjct: 297 AKMSKSVGNVVDPIALIEEFGADAVRYFLLREITLGQDGNISRDALIGRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R++SM  K   G+I      T+ D ++  +    ++   E M+   +  A+    +L
Sbjct: 357 LLHRTLSMAKKYRKGVIAKGTGRTDFDAALEEMAQETVKTYTEQMEQMELSAAIKTAWAL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +S  ++Y D   PW L K     A    VLY  VE +R  +IL+  F+P  A +I   L 
Sbjct: 417 ISRTNKYIDETAPWTLAKDEAKAAELDAVLYHLVESLRITSILISPFLPVTARRIHAQLG 476

Query: 479 VADENRCFQSLDQRLK--PGFMLHKTFDPIFPR 509
            A +    Q  D      P      T + +FPR
Sbjct: 477 FATDFDAVQLSDAAWGGLPDGHAVGTAEQLFPR 509


>gi|260888295|ref|ZP_05899558.1| methionine--tRNA ligase [Selenomonas sputigena ATCC 35185]
 gi|260861831|gb|EEX76331.1| methionine--tRNA ligase [Selenomonas sputigena ATCC 35185]
          Length = 665

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/512 (42%), Positives = 332/512 (64%), Gaps = 10/512 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YP+A+ HIGHAY   IAD +ARF RL   DV F TG+DEHGQKI + A+
Sbjct: 14  RKSFYITTPIYYPSAKLHIGHAYCTTIADAVARFKRLTDHDVFFLTGSDEHGQKIQQKAE 73

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT   +VD+    F+ +   L IS DDFIRTTE+RH    + ++++I +KGDIYKG 
Sbjct: 74  EEGVTPIAYVDKIVAGFQGLWQKLHISNDDFIRTTEERHQRVVQEVFRRIYEKGDIYKGK 133

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+Y+ + ++   ADG+  +     V  +EE+ YFF++S Y D++L+Y E +
Sbjct: 134 YKGLYCTPCESYWTERQL---ADGKCPDCGRE-VAEVEEDAYFFKMSHYADRVLAYIEEN 189

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P+ RRNE+I+F+K GL+DL +SR +FDWGI +P  P +++YVW DALTNYLT  G
Sbjct: 190 PDFIQPVSRRNEMINFIKQGLEDLCISRTSFDWGIPVPIAPDHVIYVWFDALTNYLTPIG 249

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           +LD+P+  + K+WPAD+H++GK+I+RFH+I WP  L++ +LPLPK V+ HG+++  G+K+
Sbjct: 250 FLDDPEKFE-KYWPADVHLVGKEIVRFHSIIWPCILMALDLPLPKMVYGHGWLIVDGDKM 308

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP+++I+E G DA+RYFL+REI  G+DG + +D L  R+NADLAN +GNL+ 
Sbjct: 309 SKSKGNVVDPVQLIDEFGADAIRYFLLREINLGQDGNFSRDALITRINADLANDLGNLLH 368

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++MI K  DG++      +E D + L+     +      M+   +  A+    + +S 
Sbjct: 369 RTLNMIGKFQDGVVEEARGESEIDRAFLADAESAIAAYEREMEEMKLQSAIKTTWAFISR 428

Query: 424 VDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D   PW L K    +   +  LY   E +R++++L++ F+P+ A KI+  L +  
Sbjct: 429 ANKYIDETMPWALAKDAAKKQELTNTLYNLAESLRRISVLIEPFMPETAAKIWHQLGMEG 488

Query: 482 ENRCFQSLDQRLKPGFMLHK---TFDPIFPRF 510
           +    +  D R   GF+      + + +FPR 
Sbjct: 489 DFSRVRFADVRTWGGFLAGTHVGSPEQLFPRI 520


>gi|253699686|ref|YP_003020875.1| methionyl-tRNA synthetase [Geobacter sp. M21]
 gi|251774536|gb|ACT17117.1| methionyl-tRNA synthetase [Geobacter sp. M21]
          Length = 509

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/506 (44%), Positives = 325/506 (64%), Gaps = 12/506 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I Y N  PHIGHAY  + ADVLAR+ RL G DV F TGTDEHGQK+ KAA  AG 
Sbjct: 6   YVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFDVFFLTGTDEHGQKVEKAAIAAGE 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T     D+  + F+ + + L+IS  DFIRTT++RH     +L++++ +KGDIY G Y  W
Sbjct: 66  TPLELADRVMKRFQSLWEKLEISNTDFIRTTQERHKKGVSVLFERVMEKGDIYLGEYEDW 125

Query: 128 YSLRDEAYYNDDEV--YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           Y    E ++ + ++  YK  D       + P + ++EE YFFR+S YQD+LL++ E++P+
Sbjct: 126 YCTPCETFWTETQLIDYKCPDC------NRPTEKLKEESYFFRMSKYQDQLLAHIEANPD 179

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNE+ISFVK GL+DLS+SR TF WGI +P + ++++YVW DALTNY+T  GY 
Sbjct: 180 FIQPKSRRNEIISFVKEGLRDLSVSRTTFQWGIPVPGNDKHVVYVWFDALTNYITALGYP 239

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D   G+  K+WP D+H+IGKDILRFH +YWP FL++A LP+PKKVF+HG+   +G+K+SK
Sbjct: 240 DEA-GNFGKYWPCDVHLIGKDILRFHTVYWPTFLMAAGLPIPKKVFAHGWWTVEGQKMSK 298

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SL NV++P  ++++ GVDA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL++RS
Sbjct: 299 SLQNVVEPNMLVDKYGVDAVRYFLLREVPFGLDGDFSHQALVHRINSDLANDLGNLLNRS 358

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +M+ K + G++  PG  TE D +     + ++ ++   +++    RAL  V  ++S  +
Sbjct: 359 TAMLGKYFGGVLQAPGEETELDAAYREKTAAMIGQVDGFIEDLAFSRALQAVWEVISAGN 418

Query: 426 RYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           +Y D   PW L K     +R +TV+Y  +E  R +  LL AF+PK + K    L      
Sbjct: 419 KYIDETAPWTLAKDPEKRERLATVMYYMLESQRVVYSLLCAFMPKTSEKGLCCLGWPKAA 478

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPR 509
                    LKPG  + K  + +FPR
Sbjct: 479 EAADLAWGGLKPGTSIAKA-EALFPR 503


>gi|319891443|ref|YP_004148318.1| Methionyl-tRNA synthetase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161139|gb|ADV04682.1| Methionyl-tRNA synthetase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323465387|gb|ADX77540.1| methionyl-tRNA synthetase [Staphylococcus pseudintermedius ED99]
          Length = 657

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 226/521 (43%), Positives = 338/521 (64%), Gaps = 15/521 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+   HIGHAY  +  DV+AR+ RL G DV + TGTDEHGQKI + AQ
Sbjct: 3   KDTFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRLQGFDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
           NAG++   ++D   ++ + + + LDIS DDFIRTTE+RH +    +++K+  KGDIY G 
Sbjct: 63  NAGMSELDYLDGMIKDIKALWEKLDISNDDFIRTTERRHTEVVEKIFEKLLSKGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVY---KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE +Y +    D VY   K   G+  ++ H  V+ ++EE YFF+LS Y D+L
Sbjct: 123 YEGWYSVPDETFYTETQLVDPVYEDGKIVGGKSPDSGHE-VELVKEESYFFKLSNYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L++Y++HPEFI P  R+NE+I+ F+K GL+DL++SR +F+WG+K+P +P++++YVW+DAL
Sbjct: 182 LAFYDAHPEFIQPPSRKNEMINNFIKPGLEDLAVSRTSFNWGVKVPSNPKHVVYVWLDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY++  GYL + D    ++WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYVSALGYLTDDDHLFRQYWPADIHLMAKEIVRFHSIIWPIILMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           +L K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +    R N DLA
Sbjct: 302 VLMKDGKMSKSKGNVMDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVDRTNFDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K +DG +P   G   E DE +  +    ++   E+M       AL
Sbjct: 362 NDLGNLVNRTISMINKYFDGELPAYQGPTHELDEEMEQMALDTVRAYHESMDKLQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANK 472
           + V  L+S  ++Y D   PW L K    +A+   V+   VE IR  A+LL+ F+     +
Sbjct: 422 STVWKLISRTNKYIDETTPWILAKDESQKAALGNVMAHLVENIRFAAVLLRPFLTHAPYQ 481

Query: 473 IFDILFVADEN-RCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           IF+ L + +E    F+ L    +L    M+ +   PIFPR 
Sbjct: 482 IFEQLHIHNEALHGFEGLATYGQLTEPIMVTEKPQPIFPRL 522


>gi|150021072|ref|YP_001306426.1| methionyl-tRNA synthetase [Thermosipho melanesiensis BI429]
 gi|149793593|gb|ABR31041.1| methionyl-tRNA synthetase [Thermosipho melanesiensis BI429]
          Length = 634

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 320/486 (65%), Gaps = 5/486 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +K Y++T I Y N++PHIG AY  II D++AR+ RL G DV + TGTDEHGQKI +AA+ 
Sbjct: 2   KKFYLTTPIYYVNSEPHIGSAYTTIIGDIIARYKRLIGYDVFYLTGTDEHGQKIMQAAKK 61

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
             +  K   D+ S  F  +   L I+ D FIRTT+ +H  T ++   K+ + GDIYKG Y
Sbjct: 62  REIEPKQLCDELSEKFSQLWKDLKITNDYFIRTTDPKHMKTVQLFVSKMLENGDIYKGIY 121

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY +  E Y+N+DE  +             + ++EEE YFFRLS Y + LL +++ +P
Sbjct: 122 KGWYCIPCETYWNEDETEQIEGKHICPTCGRELNFVEEENYFFRLSKYTEPLLKHFKENP 181

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +F+ P  RRNE++  ++SGLKDLS++R TFDWGI +P+DP +++YVW+DAL NY++  GY
Sbjct: 182 DFVEPDFRRNEMLKILESGLKDLSITRTTFDWGIPMPNDPNHVIYVWVDALINYISAIGY 241

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
             + +  + K+WPADLH+IGK+I RFH++ WPA L+S  LPLPKK+F+HG++   G+KIS
Sbjct: 242 GSDQEKFE-KWWPADLHLIGKEINRFHSLIWPAMLMSVGLPLPKKIFAHGWLTVNGQKIS 300

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSLGN IDP E +++ G D +RY+L R+I  GKDG + ++ L  R+N+DLAN  GNL+ R
Sbjct: 301 KSLGNAIDPREFVKKYGNDVVRYYLARDIVFGKDGDFSEENLVHRLNSDLANDYGNLLHR 360

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           +++M++K++D +IP P    E DE ++     V ++  E M++  +  AL  +   +  +
Sbjct: 361 TIAMVVKNFDSIIPEPNNIQEIDEKLIKEYFEVKEKYLEYMESYKLTNALETIWEYIRYI 420

Query: 425 DRYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           ++YFD  KPW L K+ N  R STVLY T+E   ++A LL  F+P  + ++F+ L    + 
Sbjct: 421 NKYFDENKPWVLAKEGNKGRLSTVLYNTLEAFLKVATLLIPFMPYSSEEVFNRL---GQE 477

Query: 484 RCFQSL 489
           R FQ +
Sbjct: 478 RNFQKI 483


>gi|148270780|ref|YP_001245240.1| methionyl-tRNA synthetase [Thermotoga petrophila RKU-1]
 gi|147736324|gb|ABQ47664.1| methionyl-tRNA synthetase [Thermotoga petrophila RKU-1]
          Length = 629

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 311/470 (66%), Gaps = 2/470 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N++PHIG AY  I+AD++AR+ R  G DV F TGTDEHGQK+ +AAQ A
Sbjct: 2   KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQA 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   + F D+ +  F+ +   L I+ D FIRTT++ H  T +    K+ + GD+YKG Y 
Sbjct: 62  GKDPQEFCDELAEKFKQLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYK 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY +  E ++N+DEV K  + ++      PV+W+EEE YFFRLS Y+D LL YYE HP+
Sbjct: 122 GWYCVPCETFWNEDEVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDPLLKYYEEHPD 181

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE++  ++ GLKDLS++R TF WG+ + DDP++++YVW+DAL NY++  GY 
Sbjct: 182 FVEPDFRRNEMLKILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYG 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            N D    K+WPADLH+IGK+I RFH+I WPA L+S  LPLPKKVF+HG++   G+KISK
Sbjct: 242 WN-DEMFNKWWPADLHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGN IDP   ++  G D +RY+L+R+I  GKDG + ++ L  R+N+DLAN  GNL+ R 
Sbjct: 301 SLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRI 360

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +MI K ++G +P+P A    D  +            E M +  +  AL ++   +++V+
Sbjct: 361 TAMIKKYFNGRLPSPSAQEGLDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVN 420

Query: 426 RYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           +YF+  KPW L K+ N +R  TVLY ++E + ++A++    +P  + ++F
Sbjct: 421 KYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSKEVF 470


>gi|170289510|ref|YP_001739748.1| methionyl-tRNA synthetase [Thermotoga sp. RQ2]
 gi|170177013|gb|ACB10065.1| methionyl-tRNA synthetase [Thermotoga sp. RQ2]
          Length = 629

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 311/470 (66%), Gaps = 2/470 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N++PHIG AY  I+AD++AR+ R  G DV F TGTDEHGQK+ +AAQ A
Sbjct: 2   KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQA 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   + F D+ +  F+ +   L I+ D FIRTT++ H  T +    K+ + GD+YKG Y 
Sbjct: 62  GKDPQEFCDELAEKFKQLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYK 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY +  E ++N+DEV K  + ++      PV+W+EEE YFFRLS Y+D LL YYE HP+
Sbjct: 122 GWYCVPCETFWNEDEVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDPLLKYYEEHPD 181

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE++  ++ GLKDLS++R TF WG+ + DDP++++YVW+DAL NY++  GY 
Sbjct: 182 FVEPDFRRNEMLKILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYG 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            N D    K+WPADLH+IGK+I RFH+I WPA L+S  LPLPKKVF+HG++   G+KISK
Sbjct: 242 WN-DEMFNKWWPADLHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGN IDP   ++  G D +RY+L+R+I  GKDG + ++ L  R+N+DLAN  GNL+ R 
Sbjct: 301 SLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRI 360

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +MI K ++G +P+P A    D  +            E M +  +  AL ++   +++V+
Sbjct: 361 TAMIKKYFNGRLPSPSAQEGLDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVN 420

Query: 426 RYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           +YF+  KPW L K+ N +R  TVLY ++E + ++A++    +P  + ++F
Sbjct: 421 KYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSKEVF 470


>gi|327438102|dbj|BAK14467.1| methionyl-tRNA synthetase [Solibacillus silvestris StLB046]
          Length = 653

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/517 (42%), Positives = 335/517 (64%), Gaps = 11/517 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E++  YI+T I YP+ + HIG AY  + +D +AR+ RL G DV F TG DEHGQKI +
Sbjct: 1   MSEQQTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLKGFDVRFLTGMDEHGQKIQE 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ A +  + +V++ +   + + + +DISY+DFI+TTE RH D+   +++K  D GDIY
Sbjct: 61  KAQEANMHPQDYVNEIAEGAKKLWNTMDISYNDFIQTTETRHTDSVEKIFQKFLDNGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y +  E+YY + ++    DG+  +   + VQ ++EE YFF +  Y D+LL+YY
Sbjct: 121 KGEYEGLYCVPCESYYTETQL---VDGKCPDCGRD-VQKVKEESYFFNMKKYADRLLAYY 176

Query: 181 ESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           E++PEFI P  R+NE+I+ F+K GL+DLS+SR +FDWGIK+P +P++++YVW+DAL+NY+
Sbjct: 177 ENNPEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKVPGNPKHVIYVWVDALSNYI 236

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T+ GY  + +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKK+F+HGFI+ K
Sbjct: 237 TSLGYGSDNEELFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKIFAHGFIMMK 296

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
             K+SKS GNV+ P  +IE  G+DA RYFL+RE+  G+DG +  +   +R N DLAN +G
Sbjct: 297 DGKMSKSKGNVVYPEMLIERYGLDATRYFLLRELPFGQDGVFSPESFVERTNFDLANDLG 356

Query: 360 NLVSRSVSMILKDYDGMIPTPG-AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           NL++R+VSM+ K +DG+IPT     T+ DE++      V     E+M        L+++ 
Sbjct: 357 NLLNRTVSMMNKYFDGVIPTENLEATQFDEALKEHAESVRIRYEESMDKMQFSVVLSELW 416

Query: 419 SLVSEVDRYFDAQKPWELKKTNPD--RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
           SLVS  ++Y D   PW L K   D  + + V+    E +R +A+++Q F+     +I + 
Sbjct: 417 SLVSRTNKYIDETSPWVLAKDEADHNKLAAVMNNLAESLRHIAVMIQPFMTNAPKQIIEQ 476

Query: 477 LFVADEN---RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           L + +++      ++    +     + +   PIFPR 
Sbjct: 477 LGLDEKSLQWDTIETFGNVIPKNIKVAEKGTPIFPRL 513


>gi|15643843|ref|NP_228891.1| methionyl-tRNA synthetase [Thermotoga maritima MSB8]
 gi|6094407|sp|O33925|SYM_THEMA RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|4981630|gb|AAD36162.1|AE001768_11 methionyl-tRNA synthetase [Thermotoga maritima MSB8]
 gi|2645225|gb|AAB87143.1| methionyl-tRNA synthetase [Thermotoga maritima MSB8]
          Length = 629

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 311/470 (66%), Gaps = 2/470 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N++PHIG AY  I+AD++AR+ R  G DV F TGTDEHGQK+ +AAQ A
Sbjct: 2   KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQA 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   + F D+ +  F+ +   L I+ D FIRTT++ H  T +    K+ + GD+YKG Y 
Sbjct: 62  GKDPQEFCDELAEKFKRLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYK 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY +  E ++N+DEV K  + ++      PV+W+EEE YFFRLS Y+D LL YYE HP+
Sbjct: 122 GWYCVPCETFWNEDEVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDSLLKYYEEHPD 181

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE++  ++ GLKDLS++R TF WG+ + DDP++++YVW+DAL NY++  GY 
Sbjct: 182 FVEPDFRRNEMLKILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYG 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            N D    K+WPADLH+IGK+I RFH+I WPA L+S  LPLPKKVF+HG++   G+KISK
Sbjct: 242 WN-DEMFNKWWPADLHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGN IDP   ++  G D +RY+L+R+I  GKDG + ++ L  R+N+DLAN  GNL+ R 
Sbjct: 301 SLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRI 360

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +MI K ++G +P+P A    D  +            E M +  +  AL ++   +++V+
Sbjct: 361 TAMIKKYFNGRLPSPSAQEGFDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVN 420

Query: 426 RYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           +YF+  KPW L K+ N +R  TVLY ++E + ++A++    +P  + ++F
Sbjct: 421 KYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSEEVF 470


>gi|281413086|ref|YP_003347165.1| methionyl-tRNA synthetase [Thermotoga naphthophila RKU-10]
 gi|281374189|gb|ADA67751.1| methionyl-tRNA synthetase [Thermotoga naphthophila RKU-10]
          Length = 629

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 310/470 (65%), Gaps = 2/470 (0%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N++PHIG AY  I+AD++AR+ R  G DV F TGTDEHGQK+ +AAQ A
Sbjct: 2   KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQA 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   + F D+ +  F+ +   L I+ D FIRTT++ H  T +    K+ + GD+YKG Y 
Sbjct: 62  GKDPQEFCDELAEKFKQLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYK 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY +  E ++N+DEV K  +  +      PV+W+EEE YFFRLS Y+D LL YYE HP+
Sbjct: 122 GWYCVPCETFWNEDEVIKEGEEHFCPECKRPVKWVEEENYFFRLSKYRDPLLKYYEEHPD 181

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE++  ++ GLKDLS++R TF WG+ + DDP++++YVW+DAL NY++  GY 
Sbjct: 182 FVEPDFRRNEMLKILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYG 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            N D    K+WPADLH+IGK+I RFH+I WPA L+S  LPLPKKVF+HG++   G+KISK
Sbjct: 242 WN-DEMFNKWWPADLHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SLGN IDP   ++  G D +RY+L+R+I  GKDG + ++ L  R+N+DLAN  GNL+ R 
Sbjct: 301 SLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRI 360

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +MI K ++G +P+P A    D  +            E M +  +  AL ++   +++V+
Sbjct: 361 TAMIKKYFNGRLPSPSAQEGLDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVN 420

Query: 426 RYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           +YF+  KPW L K+ N +R  TVLY ++E + ++A++    +P  + ++F
Sbjct: 421 KYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSKEVF 470


>gi|313672884|ref|YP_004050995.1| methionyl-tRNA synthetase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939640|gb|ADR18832.1| methionyl-tRNA synthetase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 636

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 308/469 (65%), Gaps = 6/469 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +   Y++T I Y N  PHIGHAY  + ADV++R+ RL G DV F TGTDEHGQKI  AA+
Sbjct: 3   KPTFYVTTPIYYVNDVPHIGHAYTTVAADVISRYKRLSGYDVFFLTGTDEHGQKIEMAAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+T K   D+    F+++   L+ISYD FIRTT+  H  + + ++KK+ D GDIY+G 
Sbjct: 63  KQGITPKQLADKVVERFKNLWIKLNISYDKFIRTTDDYHKKSVQYIFKKMMDNGDIYQGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY    E Y+ + ++    DG    +       ++E  YFF++S YQD LL + E +
Sbjct: 123 YEGWYCTPCETYWTETQLL---DGNCCPSCRRETTRLKEPSYFFKMSKYQDALLKHIEEN 179

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P  RRNE+ISF+K GL+DLS+SR +F WG+++PDDP++++YVWIDALTNY++  G
Sbjct: 180 PDFIKPASRRNEIISFIKEGLRDLSVSRVSFKWGVQVPDDPKHVIYVWIDALTNYISALG 239

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y  N D    K+WPAD H++GKDILRFH +YWP  L+S  +PLPK VF+HG+   +G+K+
Sbjct: 240 Y-PNEDDLFGKYWPADFHIVGKDILRFHTVYWPTMLMSIGVPLPKSVFAHGWWTVEGQKM 298

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDP  ++++ GVD +RYFL+RE+  G DG +    L  R+N DL+N +GNL++
Sbjct: 299 SKSLGNAIDPNWLVDKFGVDQIRYFLMREVPFGLDGDFSFKALIHRINGDLSNDLGNLLN 358

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R++ M+ + +DG++         D+ I  +     +E+ +N+Q+   ++AL  +  LVS 
Sbjct: 359 RTLGMLNRYFDGVVQPYVVGDPEDDRIAELIVSTFKEMDKNLQDLAFNKALGTIWELVSA 418

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           ++++ D   PW L K  +  DR  +VLYV ++ IR L+++L  F+P  A
Sbjct: 419 LNKFIDTMAPWNLAKDPSKRDRLGSVLYVVLDGIRALSLMLYPFMPNTA 467


>gi|295694735|ref|YP_003587973.1| methionyl-tRNA synthetase [Bacillus tusciae DSM 2912]
 gi|295410337|gb|ADG04829.1| methionyl-tRNA synthetase [Bacillus tusciae DSM 2912]
          Length = 684

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/519 (43%), Positives = 327/519 (63%), Gaps = 21/519 (4%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YP+ + HIGHAY  + AD +AR+ RL G DV++ TGTDEHGQKI + A+
Sbjct: 3   RKTFYITTPIYYPSNKLHIGHAYTTVAADAMARYKRLRGYDVMYLTGTDEHGQKIERRAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G T + FVD+     +++   LDISYDDFIRTTE RH    + +++++ ++GDIY+  
Sbjct: 63  EEGKTPQAFVDEIVGWIQELWRKLDISYDDFIRTTEPRHKKAVQRIFQRLMEQGDIYQAD 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+++      + A+G        PV+ + E+ YFFR+S Y  +LL YYE +
Sbjct: 123 YEGLYCTPCESFWT----ARQAEGGRCPDCGRPVELVREKSYFFRMSKYVPQLLRYYEEN 178

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           PEFI P  R++E+I+ F+K GL+DL +SR TFDWGI +P DP +++YVWIDAL+NY+T  
Sbjct: 179 PEFIQPESRKHEMINNFIKPGLEDLCVSRTTFDWGIPVPGDPDHVIYVWIDALSNYITAL 238

Query: 243 GYLDNPDGSKAKF---WPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           GYL +    + KF   WPAD+ V+GK+I+RFH IYWP  L++  LPLPKKVF HG++L  
Sbjct: 239 GYLSDDPAEREKFDRYWPADVQVVGKEIVRFHTIYWPIMLIALGLPLPKKVFGHGWLLTP 298

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
             K+SKS GNVIDP  +++  G DA+RYFL+REI  G DG +  + L +R+N DLAN +G
Sbjct: 299 QGKMSKSKGNVIDPNLLLDRYGSDAIRYFLLREIPFGADGVFTPEALIQRLNFDLANDLG 358

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NL++R++ +I +   G IPTP    + D  + S+ +  +  + E M+      ALA +  
Sbjct: 359 NLLNRTLPLIERFAGGRIPTPTMVQDPDGELRSLAAETVSRVEEAMEKMEFSTALAAIWQ 418

Query: 420 LVSEVDRYFDAQKPW-ELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           L+   ++Y D   PW E+K    +RA TVLY   EVIR ++ILLQ F+ K   ++   L 
Sbjct: 419 LLGRANKYIDETAPWAEMKAGRTERAHTVLYHLAEVIRIVSILLQPFLTKAPVEMQRRLG 478

Query: 479 VA-------DENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           ++       D  R F +    L PG  ++K  DP+FPR 
Sbjct: 479 LSPGPHTHWDSARMFGT----LPPGLPVYKG-DPLFPRL 512


>gi|315925586|ref|ZP_07921796.1| methionine--tRNA ligase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621127|gb|EFV01098.1| methionine--tRNA ligase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 724

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/513 (42%), Positives = 327/513 (63%), Gaps = 8/513 (1%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           +E++  Y++T I YP+   HIGH Y  + AD L RF R  G D    TG+DEHGQKI K 
Sbjct: 76  EEKKTFYMTTPIYYPSGDLHIGHTYTTVAADTLTRFKRQQGYDAYMLTGSDEHGQKIQKI 135

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  GVT K +VD      +++  +++I Y  FIRTT+  H  + + ++K++ D+GDIYK
Sbjct: 136 AEEKGVTPKAYVDGTVAKIKELWKLMNIDYSQFIRTTDADHVKSVQKIFKRLYDQGDIYK 195

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           G Y GWY   DEA++ D +V    DG+  +    PV+   EE YFFR+S Y D+LL Y E
Sbjct: 196 GRYEGWYCTPDEAFWTDTQV---VDGKCPDCGR-PVERASEEAYFFRMSKYADRLLDYIE 251

Query: 182 SHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           SHP FI P  R+ E+I+ F+K GL+DL +SR +FDWGI +  DP +++YVWIDAL+NY+T
Sbjct: 252 SHPGFIQPEARQKEMINNFIKPGLQDLCVSRTSFDWGIPVEFDPGHVVYVWIDALSNYIT 311

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYL++      ++WPADLH++GKDI+RFH IYWP  L++ +LPLPK ++ HG+IL KG
Sbjct: 312 ALGYLNDKPQLMDRYWPADLHLVGKDIIRFHTIYWPIMLMALDLPLPKTIYGHGWILLKG 371

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DP+E++++ GVD LRY +++E+  G DG Y +D L   +NADLAN +GN
Sbjct: 372 GKMSKSIGNVVDPVELVKKYGVDPLRYHVLKEMKYGADGNYSEDLLVGNINADLANDLGN 431

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+SR+V+M +K +DG IP      + D+++  V   V+Q   + M      RAL  +  L
Sbjct: 432 LLSRTVAMTVKYFDGTIPEERQSGDHDDALARVAEAVVQNYAKWMDKLDFSRALESIWEL 491

Query: 421 VSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +   ++Y D  +PW L K  +   R + VLY   E +R + +L+ A +P+ ++KI + + 
Sbjct: 492 IGRANKYIDETEPWVLGKDDSQKSRLAAVLYNLSEALRIVGVLIAAPMPETSDKILEQMR 551

Query: 479 VADENRCFQSLDQRLK-PGFMLHKTFDPIFPRF 510
           + ++   + S+      P  +  +  +P++PR 
Sbjct: 552 IPEDLATWDSIQHFGSYPSGVQVERCEPLYPRI 584


>gi|222055242|ref|YP_002537604.1| methionyl-tRNA synthetase [Geobacter sp. FRC-32]
 gi|221564531|gb|ACM20503.1| methionyl-tRNA synthetase [Geobacter sp. FRC-32]
          Length = 509

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 313/479 (65%), Gaps = 11/479 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  + ADVLAR+ RL G +V F TGTDEHGQK+ KAA  AG
Sbjct: 5   FYVTTPIYYVNDVPHIGHAYTTLAADVLARYRRLKGYEVFFLTGTDEHGQKVEKAANAAG 64

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            T +   D+  + F+ + + LDISY DFIRTT++RH      ++K + +KGDIY G Y  
Sbjct: 65  ETPQELADRVMKRFQALWEKLDISYTDFIRTTQERHKKGVSKIFKDVMEKGDIYLGEYED 124

Query: 127 WYSLRDEAYYNDDEV--YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
           WY    E ++ + ++  YK  D       + P + ++EE YFFR+S YQ++LL++ E++P
Sbjct: 125 WYCTPCETFWTETQLIDYKCPDC------NRPTEKLKEESYFFRMSKYQEQLLAHIEANP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNE+ISFVK GL+DLS+SR TF WGI +P + ++I+YVW DAL NY+T  GY
Sbjct: 179 DFIQPKSRRNEIISFVKEGLRDLSVSRTTFSWGIPVPGNDKHIIYVWFDALANYITALGY 238

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            +   G+  KFWP D H+IGKDILRFHA+YWP FL++A LPLPKKVF+HG+   +G+K+S
Sbjct: 239 PEE-SGNFDKFWPVDAHLIGKDILRFHAVYWPTFLMAAGLPLPKKVFAHGWWTIEGQKMS 297

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSL NV++P  ++E+ GVDA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL++R
Sbjct: 298 KSLQNVVEPNMLVEKYGVDAVRYFLLREVPFGLDGDFSHSALVHRINSDLANDLGNLLNR 357

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S +M+ K + G +  P   T+ D +       +++++  +++     +AL  +  +VS  
Sbjct: 358 STAMLNKYFGGTVQAPADLTDMDLAYQEKTREMVRQVDMHLEELAFSKALQAIWEVVSAG 417

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
           ++Y D   PW L K     +R +TV+Y  +E  R +  L+ AF+P+ A K    L V D
Sbjct: 418 NKYIDETAPWTLAKDPVQKERLATVMYCLLESQRIVYQLVSAFMPQTAVKALSYLGVTD 476


>gi|56961843|ref|YP_173565.1| methionyl-tRNA synthetase [Bacillus clausii KSM-K16]
 gi|56908077|dbj|BAD62604.1| methionyl-tRNA synthetase [Bacillus clausii KSM-K16]
          Length = 655

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 217/520 (41%), Positives = 336/520 (64%), Gaps = 20/520 (3%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIGH Y  +  D +AR+ RL G DV + TGTDEHGQKI + A+  G
Sbjct: 6   FYITTPIYYPSGKLHIGHTYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIEQKAKEKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           ++   + ++  +  +++   LDIS+DDFIRTTEKRH +    +++++ ++GDIY G Y G
Sbjct: 66  ISPLEYTNEMVKPIKELWKKLDISHDDFIRTTEKRHTNMVEKIFEQLVEQGDIYLGEYEG 125

Query: 127 WYSLRDEAYYNDDEVY---KGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQDKLLSY 179
           WY + DE +Y + E+    K   G     +     +PV+ + E+ YFFR+S Y D+LL++
Sbjct: 126 WYCVSDETFYGERELVDPIKDESGNIIGGKSPDSGHPVEKVREKSYFFRMSKYADRLLAF 185

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +P+FI P  R+NE+I+ F+K GL+DL++SR +F WG+K+P +P++++YVWIDALTNY
Sbjct: 186 YEENPDFIQPASRKNEMINNFIKPGLQDLAVSRTSFTWGVKVPSNPKHVVYVWIDALTNY 245

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T  GY    D    K+WPAD+H++GKDILRFH IYWP  L++ +LPLPKKVF HG+ L 
Sbjct: 246 ITALGYGTADDTLYQKYWPADVHLVGKDILRFHTIYWPIMLMALDLPLPKKVFGHGWFLT 305

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP  +I+  G+DA+RY+L+RE+  G DG +  +   +RVN DLAN +
Sbjct: 306 KDGKMSKSKGNVVDPAPLIDHFGLDAIRYYLLREVPFGADGVFTPEAFVERVNYDLANDL 365

Query: 359 GNLVSRSVSMILKDYDGMIPTPGAFTES----DESILSVCSRVLQEIRENMQNQLIHRAL 414
           GNL++R+V+MI K ++G IP   A+ +S    DE +L +    + ++ + M+      AL
Sbjct: 366 GNLLNRTVAMINKYFNGEIP---AYVKSASPFDEDLLDLVQATITKVEDAMEEMEFSIAL 422

Query: 415 AQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANK 472
           A +  LVS  ++Y D  +PW L K   +R    +V+Y   E +R +++L++ F+ +   K
Sbjct: 423 AAIWQLVSRTNKYIDETQPWMLAKEEDNRELLGSVMYHLAESLRIISVLIRPFMTRTPAK 482

Query: 473 IFDILFVADENRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
           I+  L + +    ++S+    +L  G  + K  +P+FPR 
Sbjct: 483 IWAQLGIDESLAGWESIRVFGQLPAGTKVSKG-EPVFPRL 521


>gi|238927712|ref|ZP_04659472.1| methionine--tRNA ligase [Selenomonas flueggei ATCC 43531]
 gi|238884428|gb|EEQ48066.1| methionine--tRNA ligase [Selenomonas flueggei ATCC 43531]
          Length = 516

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/475 (44%), Positives = 317/475 (66%), Gaps = 6/475 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +   YI+T I YP+A+ HIGHAY   +AD +AR+ RL G DV F TG+DEHGQKI +
Sbjct: 1   MSGKTPFYITTPIYYPSAKLHIGHAYCTTVADTIARYKRLAGFDVFFLTGSDEHGQKIQQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+  G+T   +VD+   +F+++  +L ISYDDFIRTT+ RH++  + ++++I D+GDIY
Sbjct: 61  AAEKEGITPIQYVDRIVASFQELWRLLGISYDDFIRTTQPRHYELVQDIFQRIYDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y G Y    E+Y+   ++    +G   +  H PVQ + EE YFFR+S Y D+LL+Y 
Sbjct: 121 KGEYKGLYCTPCESYWTRLQL--DENGCCPDC-HRPVQEVSEEAYFFRMSKYADRLLAYI 177

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
             HP+FI P+ RRNE+I+F++ GL+DL +SR +FDWGI +P DP++++YVW DALTNYLT
Sbjct: 178 NEHPDFIQPVSRRNEMIAFIEQGLEDLCVSRTSFDWGIPVPFDPKHVVYVWFDALTNYLT 237

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYL + +    K+WPAD+H++GK+I+RFH I W   L++  L LPKKV+ HG+++  G
Sbjct: 238 PIGYLHDKEMFH-KYWPADVHLVGKEIVRFHTIIWGCMLMALGLDLPKKVYGHGWLIVNG 296

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS+GNV+DP+ +IEE G DA+RYFL+REIA G+DG   +D L  R+N+DLAN +GN
Sbjct: 297 AKMSKSVGNVVDPVALIEEFGADAIRYFLLREIALGQDGNISRDALIGRINSDLANDLGN 356

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R++SM  K   G++      T+ D ++ ++ +  +++  E M    +  A+  V +L
Sbjct: 357 LLHRTLSMAKKYRKGVVTKGEGRTDFDAALETMTAATVRDYTEQMDAMELSAAVKTVWAL 416

Query: 421 VSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +S  ++Y D   PW L K     A    VLY  VE +  +++L+  F+P  A +I
Sbjct: 417 ISRTNKYIDETAPWTLAKDEAKAAQLDAVLYHLVETLHIVSVLIAPFMPTTARRI 471


>gi|147676404|ref|YP_001210619.1| methionyl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
 gi|146272501|dbj|BAF58250.1| methionyl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
          Length = 544

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 320/509 (62%), Gaps = 12/509 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+   HIGHAY  + AD +ARF ++ G D  F TGTDEHGQKI +AA++ G
Sbjct: 36  FYITTPIYYPSDNLHIGHAYTTVAADAVARFKKMTGYDTRFLTGTDEHGQKIERAARSRG 95

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
              + FVD+     + +   L++ YDDFIRTTE RH       ++K+ ++GDIYK  Y G
Sbjct: 96  EDPQEFVDKIVAGIKLLWQKLEVDYDDFIRTTEPRHKKVVSAFFQKLYEQGDIYKAGYEG 155

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    EA++ +  +    +G        PV+ + EE YFFR+S Y ++LL + E HPEF
Sbjct: 156 WYCTPCEAFWAESRL----EGGNCPDCGRPVELLREESYFFRMSKYAERLLRHIEEHPEF 211

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           I P  RRNE++SF+KSGL+DL +SR TF+WGI +P DP +++YVW+DALTNY++  GY  
Sbjct: 212 IQPASRRNEMVSFIKSGLEDLCVSRTTFNWGIPVPFDPGHVIYVWVDALTNYISALGYGT 271

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDI+RFH++ WP  L++A L LP++V  HG++L +  K+SKS
Sbjct: 272 EDDSLFKKYWPADVHLMGKDIVRFHSVIWPILLMAAGLELPRQVVGHGWLLLESGKMSKS 331

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ +I++ GVDA+RY+L+RE+  G DG+Y ++ L +R+N DLAN +GNLVSRS+
Sbjct: 332 KGNVVDPLVLIDKYGVDAIRYYLLRELPFGADGYYSEEALVERINKDLANDLGNLVSRSI 391

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +M+ K + G +  PG     D  ++ +  +    + E M    +  ALA +  LV   ++
Sbjct: 392 AMVEKYFQGRVQPPGLPEGPDRELIDLAEQTPAAVEELMDKMDLSGALAAIWRLVGRANK 451

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484
           Y D   PW L K  +  DR +TV+Y   E +R + +++  F+PKL  +++  L +  ENR
Sbjct: 452 YVDETAPWGLAKDPSRADRLATVMYNLAESLRFITVMVSPFMPKLPARVWAQLGL--ENR 509

Query: 485 ----CFQSLDQRLKPGFMLHKTFDPIFPR 509
                ++SL     P     K    +FPR
Sbjct: 510 PELHTWESLVWGKLPANTCVKRGPALFPR 538


>gi|254797222|ref|YP_003082063.1| methionyl-tRNA synthetase [Neorickettsia risticii str. Illinois]
 gi|254590469|gb|ACT69831.1| methionyl-tRNA synthetase [Neorickettsia risticii str. Illinois]
          Length = 521

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/507 (43%), Positives = 318/507 (62%), Gaps = 14/507 (2%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           + Y++T + Y N  PHIGHAY  +IADVL R  RL G +V FTTGTDEHGQK+   A+  
Sbjct: 20  RYYVTTPVYYVNDNPHIGHAYSSLIADVLTRALRLAGHEVRFTTGTDEHGQKVQNTAKKH 79

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G     FVD  SR FRD+   +   + DFIRTTE RH +  + LW  IS    I  G YS
Sbjct: 80  GKCEIDFVDHVSRRFRDLCVAMHYEFSDFIRTTETRHKEAVQTLWSTISKNNSISLGEYS 139

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWYS RDEA+Y + E+  G           PV W +E  YFF+LS + + L   Y  +P 
Sbjct: 140 GWYSERDEAFYTEAELQNG-----LAPTGAPVSWTKEACYFFKLSQFSEPLKKLYAENPT 194

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  R NE+++F+ +G+ DLS+SR    WGI +PDDP + +YVW+DALTNY+++ GY 
Sbjct: 195 FIQPKSRFNEMLAFLNTGMHDLSISRTRVKWGINVPDDPAHTVYVWLDALTNYVSSIGYP 254

Query: 246 D-NPDGSKAKFWPAD--LHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           + + D   + FW     +H+IGKDILRFH+IYWPAFL++ANL  P  + +HG+ L+ GEK
Sbjct: 255 NTSTDSLFSAFWDNARVIHIIGKDILRFHSIYWPAFLMAANLKTPDVILAHGWWLNDGEK 314

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           ISKSLGN+IDP E+I E GVD +RYFL+REI  GKDG + K  LK+R+N++LA+ IGNL 
Sbjct: 315 ISKSLGNIIDPFELISEFGVDPVRYFLIREITVGKDGNFSKVNLKERINSELADNIGNLF 374

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
            R++++  K    + P  G   ES+  +L     + +E + +++   ++ +L ++I L S
Sbjct: 375 HRTLTLTAK---LLGPKIGEIYESENELLEFAYSLAKEYKNDIELLDLNSSLDRIIQLSS 431

Query: 423 EVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           + + Y   ++PW+LK+  P+ A  +L+  +E +R +AI LQ FVP+ A+ + D+L V   
Sbjct: 432 KANEYISMEEPWKLKE-KPETAGRILHSVLEALRVIAIGLQPFVPQSASTMLDLLAVPPG 490

Query: 483 NRCFQSLDQ--RLKPGFMLHKTFDPIF 507
            R   ++++  R +PG  +     P+F
Sbjct: 491 ERKLANMNKESRTRPGTQIKLPISPLF 517


>gi|197119575|ref|YP_002140002.1| methionyl-tRNA synthetase [Geobacter bemidjiensis Bem]
 gi|197088935|gb|ACH40206.1| methionyl-tRNA synthetase [Geobacter bemidjiensis Bem]
          Length = 509

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/506 (43%), Positives = 325/506 (64%), Gaps = 12/506 (2%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I Y N  PHIGHAY  + ADVLAR+ RL G DV F TGTDEHGQK+ KAA  AG 
Sbjct: 6   YVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFDVFFLTGTDEHGQKVEKAAIAAGE 65

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T     D+  + F+ + + L+IS  DFIRTT++RH     +L++++ +KGDIY G Y  W
Sbjct: 66  TPLELADRVMKRFQSLWEKLEISNTDFIRTTQERHKKGVSVLFERVMEKGDIYLGEYEDW 125

Query: 128 YSLRDEAYYNDDEV--YKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           Y    E ++ + ++  YK  D       + P + ++EE YFFR+S YQD+LL++ E++P+
Sbjct: 126 YCTPCETFWTETQLIDYKCPDC------NRPTEKLKEESYFFRMSKYQDQLLAHIEANPD 179

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RRNE+ISFVK GL+DLS+SR TF WGI +P + ++++YVW DALTNY+T  GY 
Sbjct: 180 FIQPKSRRNEIISFVKEGLRDLSVSRTTFQWGIPVPGNDKHVVYVWFDALTNYITALGYP 239

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
           D   G+  K+WP D+H+IGKDILRFH +YWP FL++A LP+PKKVF+HG+   +G+K+SK
Sbjct: 240 DE-QGNFGKYWPCDVHLIGKDILRFHTVYWPTFLMAAGLPIPKKVFAHGWWTVEGQKMSK 298

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           SL NV++P  ++++ GVDA+RYFL+RE+  G DG +    L  R+N+DLAN +GNL++RS
Sbjct: 299 SLQNVVEPNMLVDKYGVDAVRYFLLREVPFGLDGDFSHQALVHRINSDLANDLGNLLNRS 358

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
            +M+ K + G++  PG  T+ D +     + ++ ++   +++    RAL  +  ++S  +
Sbjct: 359 TAMLGKYFGGVLQAPGEETDLDAAYREKTAAMIGQVDGFIEDLAFSRALQAIWEVISAGN 418

Query: 426 RYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           +Y D   PW L K     +R +TV+Y  +E  R +  LL AF+PK + K    L      
Sbjct: 419 KYIDETAPWTLAKDPEKRERLATVMYYMLESQRVVYSLLSAFMPKTSEKGLCCLGWPQAP 478

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPR 509
                    LKPG  + K  + +FPR
Sbjct: 479 DAGDLAWGGLKPGTPIAKA-EALFPR 503


>gi|224475632|ref|YP_002633238.1| methionyl-tRNA synthetase [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|222420239|emb|CAL27053.1| Methionyl-tRNA synthetase [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 667

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 332/522 (63%), Gaps = 16/522 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+ + HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + A 
Sbjct: 3   KDTFYITTPIYYPSGKLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAH 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AGV+   ++D+     + + + L+IS DDFIRTTEKRH +    +++++ ++GDIY G 
Sbjct: 63  KAGVSELEYLDEMISGIKSLWEKLEISNDDFIRTTEKRHEEVVAKVFERLLEQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDE----VY----KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDK 175
           Y GWYS+ DE YY + +    VY    K   G+  ++ H  V+ ++EE YFF +S Y D+
Sbjct: 123 YEGWYSVPDETYYTESQLEEPVYDDNGKIIGGKSPDSGHE-VELVKEESYFFNISKYADR 181

Query: 176 LLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDA 234
           LL++Y+ HPEFI P  R+NE+I+ F+K GL DL++SR TFDWG+++P +P++++YVWIDA
Sbjct: 182 LLAFYDEHPEFIQPPSRKNEMINNFIKPGLTDLAVSRTTFDWGVQVPSNPKHVVYVWIDA 241

Query: 235 LTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294
           L NY++  GYL   D    K+WPADLH++ K+I+RFH+I WP  L++ +LPLPK+VF+HG
Sbjct: 242 LVNYISALGYLSEDDSLFKKYWPADLHLMAKEIVRFHSIVWPILLMALDLPLPKRVFAHG 301

Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354
           +IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +    R N DL
Sbjct: 302 WILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVDRTNFDL 361

Query: 355 ANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRA 413
           AN +GNLV+R+++MI K +DG +P   G   E D  +       ++E  ENM+N     A
Sbjct: 362 ANDLGNLVNRTIAMINKYFDGELPAYEGPKHELDAEMEQFALDTVKEYHENMENLQFSVA 421

Query: 414 LAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLAN 471
           L+ V   +S  ++Y D   PW L K +  +     V+   VE IR   +LL+ F+     
Sbjct: 422 LSTVWKFISRTNKYIDETTPWVLAKDDSQKEMLGNVMAHLVENIRFATVLLRPFITHAPR 481

Query: 472 KIFDILFV-ADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +IF+ L + + E   F SL++   LK    + +   PIFPR 
Sbjct: 482 QIFEQLNINSPELFGFDSLNEYGALKAPISVTEKPQPIFPRL 523


>gi|220932862|ref|YP_002509770.1| methionyl-tRNA synthetase [Halothermothrix orenii H 168]
 gi|219994172|gb|ACL70775.1| methionyl-tRNA synthetase [Halothermothrix orenii H 168]
          Length = 653

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/511 (43%), Positives = 323/511 (63%), Gaps = 13/511 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I YP+ + HIGHAY  + AD LA+F  +   D +F TG+DEHGQKI + A  AG
Sbjct: 6   FYVTTPIYYPSDRLHIGHAYTTVAADTLAKFKEMQDYDTMFLTGSDEHGQKIERKASEAG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
                +VD+    F+D+   L + YD FIRTT   H    + ++KKI +KGDIYKG Y G
Sbjct: 66  KKPGEYVDEIVATFKDLWKRLGVDYDYFIRTTNPDHEKVVQEIFKKIYEKGDIYKGKYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQ-HNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           WY    E ++ + ++    +G+        PV+W+EEE YFF+LS Y D+LL + + HPE
Sbjct: 126 WYCTPCETFWTERQL----EGEKVCPDCGRPVEWVEEESYFFKLSKYADRLLEHIKKHPE 181

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P  RR E+I+F++SGL+DLS+SR TFDWGI +P D  +++YVW DAL+NY++  GYL
Sbjct: 182 FIQPESRRKEMINFIESGLEDLSVSRTTFDWGIPVPIDDDHVIYVWFDALSNYISAIGYL 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            + D     +WPAD+H++GKDILRFH I WP  L++ +LPLPKKVF HG++L +  K+SK
Sbjct: 242 SD-DKKFNHYWPADVHIVGKDILRFHTIIWPIILMALDLPLPKKVFGHGWLLTETGKMSK 300

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP ++I++ GVD +RY+L+RE+A G+DG Y  + L KR+N+DLAN +GNL+ R+
Sbjct: 301 SKGNVVDPNKLIDDFGVDPIRYYLLREVAFGQDGTYSTEALIKRINSDLANDLGNLLHRT 360

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           V+M+ K +DG+IP PG   E D+ + +   + L EI  +M N     AL  + + +   +
Sbjct: 361 VTMVDKYFDGVIPEPGVEKEVDKDLKNYALKTLDEIDNSMDNLKYAVALESLWNFIRRSN 420

Query: 426 RYFDAQKPWELKKTN--PDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD-- 481
           +Y D   PW L +     DR  TVLY  +E +R +A +L+ F+ +    I + +   D  
Sbjct: 421 KYIDQTTPWILARDEDKKDRLGTVLYNLIEALRIIAGMLKPFLVETPYMIGEQINARDLI 480

Query: 482 ENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           E   +  L Q   L PG  + K   PI+PR 
Sbjct: 481 EKASWSDLKQWGLLSPGRKVKKG-KPIYPRI 510


>gi|114776564|ref|ZP_01451609.1| methionyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1]
 gi|114553394|gb|EAU55792.1| methionyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1]
          Length = 512

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/517 (42%), Positives = 325/517 (62%), Gaps = 18/517 (3%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           E  Y++T I Y N +PH+GH Y  I ADVLAR+ R+ G DV F TG DEHGQK+ +AA+ 
Sbjct: 2   ESYYVTTPIYYVNDEPHLGHIYTTIAADVLARYQRMAGRDVFFLTGVDEHGQKVQQAAEA 61

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
            G+      DQ    ++ +   L I+ DDFIRT+  RH    + +W+++ + G IYKG Y
Sbjct: 62  RGIEPIELADQVVERYQSLWPELAITNDDFIRTSSDRHRRGVQAMWRRLENAGAIYKGFY 121

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNP-----VQWMEEEGYFFRLSAYQDKLLSY 179
             WY +  E Y+ + ++    D   +  +H P     V+ ++EE YFFRLSAYQD+LL Y
Sbjct: 122 EDWYCVPCETYWTETQL---NDADCWEEKHCPDCKRAVEKVQEESYFFRLSAYQDRLLEY 178

Query: 180 YESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
             ++P+FI P  RRNEV+ FV+SGL DLS+SR TF WG+ +P D ++++YVWIDALTNYL
Sbjct: 179 INANPDFIGPASRRNEVLRFVESGLNDLSVSRTTFSWGVPVPGDEKHVIYVWIDALTNYL 238

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           +  G+   PD    K+WPAD+H+IGKDILRFHAIYWP  L++A+LPLP+++F+HG+   +
Sbjct: 239 SALGF---PDQELPKYWPADVHLIGKDILRFHAIYWPCMLMAADLPLPQRLFAHGWWTVE 295

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           GEK+SKS GN + P +++E+   D +RYFL+RE+  G+DG +    +K+R N+DLAN +G
Sbjct: 296 GEKMSKSKGNALRPADLLEQYDADVIRYFLLREVPFGQDGDFSFSAMKQRYNSDLANDVG 355

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NL++RS++M+ K  DG++  PG     D ++++    + +++  +M  Q  H AL ++  
Sbjct: 356 NLLNRSLAMLNKYRDGVLAEPGDEQAVDRTLIADVEGMQRDVAAHMNKQAFHLALERISV 415

Query: 420 LVSEVDRYFDAQKPWELKKTNPD-RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478
           +V   +RY +   PW L K   + R +TVLY   E +R +A+ L  F+P   + + + + 
Sbjct: 416 VVRHGNRYVEENAPWSLAKAGDEARLNTVLYHLAETLRLVALQLMPFMPGKMSAMLNQIQ 475

Query: 479 VAD---ENRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
            A+   +   F S      LKPG    K   P+FPR 
Sbjct: 476 GAELMSQTLTFASHGGWGLLKPGHQCEKP-QPLFPRM 511


>gi|295105205|emb|CBL02749.1| methionyl-tRNA synthetase [Faecalibacterium prausnitzii SL3/3]
          Length = 665

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/515 (41%), Positives = 320/515 (62%), Gaps = 15/515 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E +  YI+T I YP+ + HIGH+Y  +  D LARF R+ G DV+F TGTDEHGQKI  
Sbjct: 1   MSEHKTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGYDVMFLTGTDEHGQKIQD 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A +AGVT K +VD+     +D+  +LD+SYD FIRTT+  H ++C+ ++ K+ ++GDIY
Sbjct: 61  KAADAGVTPKEYVDKIVATVKDLWKLLDVSYDRFIRTTDDYHMESCQKIFTKLYEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKG----ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           KG Y G Y    E+++ D ++  G       + Y+A         EE YFF+ S Y D+L
Sbjct: 121 KGEYIGHYCKPCESFWTDSQLVDGKCPDCGREVYDAH--------EEAYFFKTSKYADRL 172

Query: 177 LSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALT 236
           L  YE +P+FI P  R+NE+I+F+K GL+D  +SR +  WGI +P DP++ MYVW+DAL+
Sbjct: 173 LKLYEENPQFIQPESRKNEMIAFIKQGLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALS 232

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY++  GY +       KFWPADLH++GK+ILRFH I WPA L++ +LPLPK+VF HG++
Sbjct: 233 NYISALGYGNETYHDYDKFWPADLHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWL 292

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L  G K+SKS+GNV+DP+ + +  GVDA+RYFL+REI  G DG +  + L  R+N+DLAN
Sbjct: 293 LMNGGKMSKSVGNVVDPVILCDRYGVDAIRYFLLREIPFGNDGMFTNEALINRINSDLAN 352

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL+SR+V+M  K + G +         D  + ++ + +  ++  +M +  I +AL +
Sbjct: 353 DLGNLLSRTVAMCEKYFGGTVHNVAGTEAIDTELETMVNELTAKVTADMDDLTIPQALME 412

Query: 417 VISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           + +++   ++Y D   PW L K   N  R  +VLY   E +R   ILL A++P  A K+ 
Sbjct: 413 IFAVIQRANKYIDETAPWALAKDEANKQRLESVLYHLCEALRVCGILLNAYLPTTAPKMM 472

Query: 475 DILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
           + L +              +  + +HK  + +FPR
Sbjct: 473 EQLGLDASALDLTKTTYGAQQTYTVHKG-EALFPR 506


>gi|160943218|ref|ZP_02090454.1| hypothetical protein FAEPRAM212_00704 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445457|gb|EDP22460.1| hypothetical protein FAEPRAM212_00704 [Faecalibacterium prausnitzii
           M21/2]
          Length = 665

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/515 (41%), Positives = 320/515 (62%), Gaps = 15/515 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E +  YI+T I YP+ + HIGH+Y  +  D LARF R+ G DV+F TGTDEHGQKI  
Sbjct: 1   MSEHKTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGYDVMFLTGTDEHGQKIQD 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A +AGVT K +VD+     +D+  +LD+SYD FIRTT+  H ++C+ ++ K+ ++GDIY
Sbjct: 61  KAADAGVTPKEYVDKIVATVKDLWKLLDVSYDRFIRTTDDYHMESCQKIFTKLYEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKG----ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           KG Y G Y    E+++ D ++  G       + Y+A         EE YFF+ S Y D+L
Sbjct: 121 KGEYIGHYCKPCESFWTDSQLVDGKCPDCGREVYDAH--------EEAYFFKTSKYADRL 172

Query: 177 LSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALT 236
           L  YE +P+FI P  R+NE+I+F+K GL+D  +SR +  WGI +P DP++ MYVW+DAL+
Sbjct: 173 LKLYEENPQFIQPESRKNEMIAFIKQGLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALS 232

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY++  GY +       KFWPADLH++GK+ILRFH I WPA L++ +LPLPK+VF HG++
Sbjct: 233 NYISALGYGNETYHDYDKFWPADLHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWL 292

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L  G K+SKS+GNV+DP+ + +  GVDA+RYFL+REI  G DG +  + L  R+N+DLAN
Sbjct: 293 LMNGGKMSKSVGNVVDPVILCDRYGVDAIRYFLLREIPFGNDGMFTNEALINRINSDLAN 352

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL+SR+V+M  K + G +         D  + ++ + +  ++  +M +  I +AL +
Sbjct: 353 DLGNLLSRTVAMCEKYFGGTVHNVAGTEAIDTELETMVNELTAKVTADMDDLTIPQALME 412

Query: 417 VISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           + +++   ++Y D   PW L K   N  R  +VLY   E +R   ILL A++P  A K+ 
Sbjct: 413 IFAVIQRANKYIDETAPWALAKDEANKQRLESVLYHLCEALRVCGILLNAYLPTTAPKMM 472

Query: 475 DILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
           + L +              +  + +HK  + +FPR
Sbjct: 473 EQLGLDASALDLTKTTYGAQQTYTVHKG-EALFPR 506


>gi|323490978|ref|ZP_08096172.1| methionyl-tRNA synthetase [Planococcus donghaensis MPA1U2]
 gi|323395334|gb|EGA88186.1| methionyl-tRNA synthetase [Planococcus donghaensis MPA1U2]
          Length = 652

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/510 (42%), Positives = 323/510 (63%), Gaps = 10/510 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+ + HIG AY  + +D +AR+ RL G DV F TG DEHGQKI + A  AG
Sbjct: 8   FYITTPIYYPSGKFHIGTAYTTVASDAMARYKRLRGFDVRFLTGMDEHGQKIEEKANEAG 67

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
              + FVD+ +   + +  V+DI+YDDFIRTTE+RH +    ++K   D GDIYKG Y G
Sbjct: 68  KAPQEFVDEMAAAAKQVWSVMDITYDDFIRTTEERHKEGVERIFKTFLDNGDIYKGEYEG 127

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E+++ ++++  G           PVQ ++EE YFF +  Y  +LL YYE++ EF
Sbjct: 128 WYCTPCESFFTENQLENGNCPDC----GRPVQKVKEESYFFNMKKYASRLLEYYENNVEF 183

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+I+ F+K GL+DLS+SR +FDWGI +P DP++++YVW+DAL+NY+T+ GY 
Sbjct: 184 IEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIPVPGDPKHVIYVWVDALSNYITSLGYG 243

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
              D    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKKVF+HGFI+ K  K+SK
Sbjct: 244 SEDDSLFDKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGKMSK 303

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+ P  ++E  G+DA RYFL+RE+  G DG +  +   +R N DLAN +GNL++R+
Sbjct: 304 SKGNVVYPEMLVERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDLGNLLNRT 363

Query: 366 VSMILKDYDGMIPTPGAF-TESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           VSMI K   G++P      TE D  +  V ++ ++   + M+       L+++ +L+S  
Sbjct: 364 VSMINKYCGGVVPQINDLQTEFDAPLQQVAAQTVKAHEQYMEKMQFSIVLSEIWTLISRT 423

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           ++Y D  +PW L K     ++ ++V+    E +R  A++LQ F+P    +I + L + +E
Sbjct: 424 NKYIDETQPWVLAKDENAKEQLNSVMAHLAESLRMTAVMLQPFLPNAPKQIIEQLGLTEE 483

Query: 483 NRCFQSLD--QRLKPGFMLHKTFDPIFPRF 510
              + +L    ++  G  +     PIFPR 
Sbjct: 484 FLAWATLQDFAKIPAGTQVVSKGTPIFPRL 513


>gi|317120932|ref|YP_004100935.1| methionyl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
 gi|315590912|gb|ADU50208.1| methionyl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
          Length = 677

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 226/514 (43%), Positives = 312/514 (60%), Gaps = 14/514 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R + YI+T I YPN + HIGH Y  + AD LAR+HRL G D  F TGTDEHGQKI +AA+
Sbjct: 8   RGRFYITTPIYYPNDRLHIGHTYTTVAADALARYHRLRGDDTWFLTGTDEHGQKIERAAR 67

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG     ++D      + +   L ISYDDFIRT+E RH    + +++++ ++GDIYKG 
Sbjct: 68  KAGKEPLEYIDPIVEATKQLWHRLHISYDDFIRTSEPRHEQRVQQIFQRLYEQGDIYKGV 127

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    EAYY + E+    DGQ       PV+ ++EE YFFRLS Y   LL + E +
Sbjct: 128 YEGLYCTACEAYYTEAELL---DGQRCPVHETPVERLQEESYFFRLSKYAQPLLEHIERN 184

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEFI P  RRNEV++F++ GL+DLS+SR +F WGI +P DP +++YVWIDAL NY+T  G
Sbjct: 185 PEFIQPPSRRNEVVAFIRQGLQDLSVSRTSFRWGIPVPFDPDHVIYVWIDALANYITALG 244

Query: 244 YLDNPDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           +   PDG +  +FWPADLH+IGKDILRFHAI WPA L++   PLP+ V+ HG++L  G K
Sbjct: 245 W---PDGERYRRFWPADLHLIGKDILRFHAIIWPALLMALGEPLPRCVYGHGWLLIDGGK 301

Query: 303 ISKSL--GNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
           I KS   G VIDP+++IE+ GVD +RYFL+RE+  G DG Y +D L +R+N DLAN +GN
Sbjct: 302 IGKSRAGGQVIDPVQLIEKYGVDPVRYFLLREVPFGDDGSYSEDALVRRLNTDLANDLGN 361

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L  R+  MI +  DG IP P     SD  + +     +  +   M    +  AL  +  L
Sbjct: 362 LAWRTTGMIQRFLDGRIPEPPG-AASDGVLAAAARETVARVERAMAGFDLPAALQAIWDL 420

Query: 421 VSEVDRYFDAQKPWELKKTN-PDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           +   ++Y D Q PW L++    DR   VLY   E  R + +LL  F+ +   +++  L +
Sbjct: 421 IGRANKYIDEQAPWALRREGRRDRLEAVLYDVAETARVVGVLLSPFLVETPPRLWTQLGL 480

Query: 480 ADENRCF---QSLDQRLKPGFMLHKTFDPIFPRF 510
             + R     + L+    PG +      P+FPR 
Sbjct: 481 GPDYRPAGWREGLEWGQLPGGVRVVRDQPLFPRI 514


>gi|99034647|ref|ZP_01314595.1| hypothetical protein Wendoof_01000592 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 471

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/474 (45%), Positives = 303/474 (63%), Gaps = 39/474 (8%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M++ E  YI+T + Y N +PHIGHAY  ++ DV+ARF +L G +V FTTGTDEHGQKI K
Sbjct: 1   MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
           AA+   +  K F D+ S +F+++A  ++  YDDFIRTTE+RH      LW ++ ++G IY
Sbjct: 61  AAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
              YSGWYS+RDEA+Y + E+    DG+        VQW++EE YFFRLS +Q+KLL  Y
Sbjct: 121 LDSYSGWYSVRDEAFYQESEL---IDGKAPTGAE--VQWIKEESYFFRLSNWQEKLLELY 175

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           ++ P FI P  RRNEVISFV+SGL DLS+SR +F+WGIK+P + ++++YVWIDALTNYLT
Sbjct: 176 KNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLT 235

Query: 241 TTGYLDNPDGSKAKFWPA----------------------------------DLHVIGKD 266
           + G+         +FW                                    ++HVIGKD
Sbjct: 236 SIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSAANLADNSFNVHVIGKD 295

Query: 267 ILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALR 326
           ILRFHA+YWPA LL+A+LPLPK++  HG+ L++GEKISKSLGNVIDPI + +E GVD LR
Sbjct: 296 ILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLR 355

Query: 327 YFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTES 386
           YFL+RE + G+DG + K  +  R+N++LAN IGNLV R++S + K   G++PT       
Sbjct: 356 YFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQSLLK 415

Query: 387 DESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTN 440
            E  L  C  +L ++  ++     +  +  +I++ SE + Y D   PW L KT+
Sbjct: 416 GEESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTD 469


>gi|313115100|ref|ZP_07800588.1| methionyl-tRNA synthetase [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622577|gb|EFQ06044.1| methionyl-tRNA synthetase [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 665

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/515 (41%), Positives = 320/515 (62%), Gaps = 15/515 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E +  YI+T I YP+ + HIGH+Y  +  D LARF R+ G DV+F TGTDEHGQKI  
Sbjct: 1   MSEHKTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGYDVMFLTGTDEHGQKIQD 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A +AGVT K +VD+     +D+  +LD+SYD FIRTT+  H ++C+ ++ K+ ++GDIY
Sbjct: 61  KAADAGVTPKEYVDKIVATVKDLWKLLDVSYDRFIRTTDDYHMESCQKIFTKLYEQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKG----ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           KG Y G Y    E+++ D ++  G       + Y+A         EE YFF+ S Y D+L
Sbjct: 121 KGEYIGHYCKPCESFWTDSQLVDGKCPDCGREVYDAH--------EEAYFFKTSKYADRL 172

Query: 177 LSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALT 236
           L  YE +P+FI P  R+NE+I+F+K GL+D  +SR +  WGI +P DP++ MYVW+DAL+
Sbjct: 173 LKLYEENPQFIQPESRKNEMIAFIKQGLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALS 232

Query: 237 NYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFI 296
           NY++  GY +       KFWPADLH++GK+ILRFH I WPA L++ +LPLPK+VF HG++
Sbjct: 233 NYISALGYGNEKYHDYDKFWPADLHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWL 292

Query: 297 LHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLAN 356
           L  G K+SKS+GNV+DP+ + +  GVDA+RYFL+REI  G DG +  + L  R+N+DLAN
Sbjct: 293 LMNGGKMSKSVGNVVDPVILCDRYGVDAIRYFLLREIPFGNDGMFTNEALITRINSDLAN 352

Query: 357 GIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQ 416
            +GNL+SR+V+M  K + G +         D  + ++ + +  ++  +M +  I +AL +
Sbjct: 353 DLGNLLSRTVAMCEKYFGGTVHNVAGTEAIDTELETMVNELTAKVTADMDSLTIPQALME 412

Query: 417 VISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474
           + +++   ++Y D   PW L K   N  R  +VLY   E +R   ILL A++P  A K+ 
Sbjct: 413 IFAVIQRANKYIDETAPWALAKDEANKARLESVLYHLCEALRVCGILLNAYLPTTAPKMM 472

Query: 475 DILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPR 509
           + L +              +  + +HK  + +FPR
Sbjct: 473 EQLGLDASALDLTKTTYGAQETYTVHKG-EALFPR 506


>gi|281419111|ref|ZP_06250128.1| methionyl-tRNA synthetase [Clostridium thermocellum JW20]
 gi|281407260|gb|EFB37521.1| methionyl-tRNA synthetase [Clostridium thermocellum JW20]
          Length = 654

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/513 (41%), Positives = 328/513 (63%), Gaps = 9/513 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +R+  YI+T I YP+ + HIGH+Y  + AD +AR+ RL G DV+F TGTDEHGQKI + A
Sbjct: 2   DRKTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT K +VD+     +++  +L I+ D FIRTT+  H  T + ++KK+ D+GDIYK 
Sbjct: 62  KEKGVTPKQYVDEIVAGIKELWKLLKITNDRFIRTTDPHHEKTVQKIFKKLYDQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++   ++    DG+  +     V+  +EE YFFRLS YQD+L+ + E 
Sbjct: 122 EYEGWYCTPCESFWTKTQL---VDGKCPDCGRE-VELTKEESYFFRLSKYQDRLIKHIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P+ R+NE+++ F++ GL+DL +SR TFDWGI +  D ++++YVWIDAL+NY+T 
Sbjct: 178 NPDFIQPVSRQNEMLNNFLRPGLEDLCVSRTTFDWGIPVSFDDKHVVYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
             Y+   D    K+WPAD+H++GK+I+RFH I WPA L++   PLPK+VF HG++L +G 
Sbjct: 238 LNYMSEDDSDYRKYWPADVHLVGKEIVRFHTIIWPAMLMALGEPLPKQVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ ++E+ GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVVLVEKYGVDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           VSR+V+MI K + G +P      E D+ ++   +   Q++ E +       AL ++   +
Sbjct: 358 VSRTVAMIDKYFGGKLPQERQAGEFDDDLIKTVTDTPQKVEELLDRLQFSTALTEIWKAI 417

Query: 422 SEVDRYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K+  N  R + VLY   E IR ++IL+Q F+P+   KI+  L +
Sbjct: 418 SRTNKYIDETMPWALAKSEENKARLAAVLYNLAESIRIVSILIQPFMPETPEKIWHQLGI 477

Query: 480 ADENRCFQSLDQR--LKPGFMLHKTFDPIFPRF 510
            D+        ++  + P        +P+FPR 
Sbjct: 478 NDKKYVEWETAKKWGVYPEGAAVNKGEPLFPRI 510


>gi|168187465|ref|ZP_02622100.1| methionyl-tRNA synthetase [Clostridium botulinum C str. Eklund]
 gi|169294617|gb|EDS76750.1| methionyl-tRNA synthetase [Clostridium botulinum C str. Eklund]
          Length = 646

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/470 (44%), Positives = 315/470 (67%), Gaps = 7/470 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+A+ HIG+ Y  I AD +ARF RL G D  F TGTDEHGQKI + A+  G
Sbjct: 6   FYITTPIYYPSAKLHIGNTYTTIAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEGKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K +VD+   + +D+  ++++SYD FIRTT+  H +T + ++KK+ D+GDIYKG Y G
Sbjct: 66  ITPKAYVDEIVADIKDLWKIMNVSYDKFIRTTDDYHIETVQKIFKKLYDQGDIYKGEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
            Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y D+L+ Y ESHP+F
Sbjct: 126 LYCTPCESFWTETQL---VDGKCPDCGR-PVEKTKEEAYFFKMSKYADRLIEYIESHPDF 181

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+++ F++ GL+DL +SR +FDWGI +  D ++++YVWIDAL+NY+T  GY 
Sbjct: 182 IQPESRKNEMLNNFLRPGLQDLCISRTSFDWGIPVSFDEKHVIYVWIDALSNYITALGYD 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
              D    K+WPA++H++GKDILRFH IYWP  L++ +LPLPK+VF HG++L  G K+SK
Sbjct: 242 QENDELYQKYWPANVHLVGKDILRFHTIYWPIMLIALDLPLPKQVFGHGWLLVDGGKMSK 301

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ ++ E G D +RY+L+ EI  G+DG Y  +   K+ N+DLAN +GNLV+R+
Sbjct: 302 SKGNVVDPVTLVNEFGTDPVRYYLLHEIPFGQDGMYTGETFIKKTNSDLANDLGNLVNRT 361

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           ++MI K +DG+IP P A  + D  ++ V     +++   M    I  AL ++ +LV   +
Sbjct: 362 IAMINKYFDGVIPAPKAEEDIDNDLIRVALEAPKKVEGKMDALKIPEALDEIWTLVRRSN 421

Query: 426 RYFDAQKPWELKKTNP--DRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +Y D   PW L K     +R  TVLY  VE +R ++++L AF+P+ + KI
Sbjct: 422 KYIDETMPWALAKEEDKRERLGTVLYNLVEGLRIVSVMLSAFLPETSKKI 471


>gi|125974586|ref|YP_001038496.1| methionyl-tRNA synthetase [Clostridium thermocellum ATCC 27405]
 gi|256004052|ref|ZP_05429037.1| methionyl-tRNA synthetase [Clostridium thermocellum DSM 2360]
 gi|125714811|gb|ABN53303.1| methionyl-tRNA synthetase [Clostridium thermocellum ATCC 27405]
 gi|255991975|gb|EEU02072.1| methionyl-tRNA synthetase [Clostridium thermocellum DSM 2360]
 gi|316941704|gb|ADU75738.1| methionyl-tRNA synthetase [Clostridium thermocellum DSM 1313]
          Length = 654

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/513 (41%), Positives = 328/513 (63%), Gaps = 9/513 (1%)

Query: 3   EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
           +R+  YI+T I YP+ + HIGH+Y  + AD +AR+ RL G DV+F TGTDEHGQKI + A
Sbjct: 2   DRKTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHGQKIERKA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT K +VD+     +++  +L I+ D FIRTT+  H  T + ++KK+ D+GDIYK 
Sbjct: 62  KEKGVTPKQYVDEIVAGIKELWKLLKITNDRFIRTTDPHHEKTVQKIFKKLYDQGDIYKS 121

Query: 123 CYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYES 182
            Y GWY    E+++   ++    DG+  +     V+  +EE YFFRLS YQD+L+ + E 
Sbjct: 122 EYEGWYCTPCESFWTKTQL---VDGKCPDCGRE-VELTKEESYFFRLSKYQDRLIKHIEE 177

Query: 183 HPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTT 241
           +P+FI P+ R+NE+++ F++ GL+DL +SR TFDWGI +  D ++++YVWIDAL+NY+T 
Sbjct: 178 NPDFIQPVSRQNEMLNNFLRPGLEDLCVSRTTFDWGIPVSFDDKHVVYVWIDALSNYITA 237

Query: 242 TGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGE 301
             Y+   D    K+WPAD+H++GK+I+RFH I WPA L++   PLPK+VF HG++L +G 
Sbjct: 238 LNYMSEDDSDYRKYWPADVHLVGKEIVRFHTIIWPAMLMALGEPLPKQVFGHGWLLLEGG 297

Query: 302 KISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNL 361
           K+SKS GNV+DP+ ++E+ GVDA+RYFL+RE+  G DG +  + L  R+N+DLAN +GNL
Sbjct: 298 KMSKSKGNVVDPVVLVEKYGVDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDLGNL 357

Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           VSR+V+MI K + G +P      E D+ ++   +   Q++ E +       AL ++   +
Sbjct: 358 VSRTVAMIDKYFGGKLPQERQAGEFDDDLIKTVTDTPQKVEELLDRLQFSTALTEIWKAI 417

Query: 422 SEVDRYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
           S  ++Y D   PW L K+  N  R + VLY   E IR ++IL+Q F+P+   KI+  L +
Sbjct: 418 SRTNKYIDETMPWALAKSEENKARLAAVLYNLAESIRIVSILIQPFMPETPEKIWHQLGI 477

Query: 480 ADENRCFQSLDQR--LKPGFMLHKTFDPIFPRF 510
            D+        ++  + P        +P+FPR 
Sbjct: 478 NDKKYVEWETAKKWGVYPEGAAVNKGEPLFPRI 510


>gi|262277217|ref|ZP_06055010.1| methionyl-tRNA synthetase [alpha proteobacterium HIMB114]
 gi|262224320|gb|EEY74779.1| methionyl-tRNA synthetase [alpha proteobacterium HIMB114]
          Length = 500

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/507 (42%), Positives = 327/507 (64%), Gaps = 10/507 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++K YI+T I YP+A+PH+GHAY  I +DV+ARF R+DG DV F TGTDEHG KI +AA+
Sbjct: 3   KKKFYITTPIYYPSAKPHMGHAYSSIASDVIARFKRIDGCDVSFLTGTDEHGLKIQRAAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
                   F D+ S+ F D+++ L++S  DFIRTTE+RH +T + LW  + +   +Y   
Sbjct: 63  EHNSDPLSFCDKISQTFIDLSNTLNLSNTDFIRTTEERHKNTVKKLWSLLQENDQLYLSK 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y+GWYS+ DEAYY ++EV +    +   +  + V WMEEE +FF+LS +Q  LL +Y+++
Sbjct: 123 YAGWYSVSDEAYYLENEVEEIDGKKISKSSGSEVTWMEEESFFFKLSEWQQPLLDFYKNN 182

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P FI P  R+NEVISF+  GLKDLS+SR TFDWGI +P++ +++MYVW+DALTNYL+ T 
Sbjct: 183 PNFIQPESRKNEVISFISGGLKDLSVSRTTFDWGIDVPNNKKHVMYVWLDALTNYLSATN 242

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y DN +G    FWPAD+H+IGKDILRFHA+YWPAFL++A LP+PK++F HG+IL   EK+
Sbjct: 243 YFDNHNG----FWPADVHIIGKDILRFHAVYWPAFLMAAKLPVPKQIFGHGWILSGEEKM 298

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GN++DP+E+I + G D +RY+L++++  G DG  + D L+  +N DLAN IGNL +
Sbjct: 299 SKSKGNILDPLELINQYGSDEIRYYLMKDVIFGLDGKINIDNLRITLN-DLANNIGNLSN 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R  +++ K+Y+  +P        +  +L     ++Q I +      +H     + S  S 
Sbjct: 358 RIFTILNKNYECKVPQINDGYTINSDLLVDKKTIIQFIDK----YELHNYTKFIHSYSST 413

Query: 424 VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADEN 483
           +++Y +  +PW  K  +      +L+ T+  ++ + ILL   +P  + K    L + +  
Sbjct: 414 INKYVNDNEPWNKKNNSEQNIKNILFSTLVALKNIFILLYPVMPLASIKFLKSLNINENQ 473

Query: 484 RCFQSLDQRLKPGFMLHKTFDPIFPRF 510
               +++++L     L K  D +F ++
Sbjct: 474 IKIDNINEKLTINDQLTKP-DILFKKY 499


>gi|330838376|ref|YP_004412956.1| Methionyl-tRNA synthetase [Selenomonas sputigena ATCC 35185]
 gi|329746140|gb|AEB99496.1| Methionyl-tRNA synthetase [Selenomonas sputigena ATCC 35185]
          Length = 655

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/513 (42%), Positives = 330/513 (64%), Gaps = 11/513 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           R+  YI+T I YP+A+ HIGHAY   IAD +ARF RL   DV F TG+DEHGQKI + A+
Sbjct: 3   RKSFYITTPIYYPSAKLHIGHAYCTTIADAVARFKRLTDHDVFFLTGSDEHGQKIQQKAE 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             GVT   +VD+    F+ +   L IS DDFIRTTE+RH    + ++++I +KGDIYKG 
Sbjct: 63  EEGVTPIAYVDKIVAGFQGLWQKLHISNDDFIRTTEERHQRVVQEVFRRIYEKGDIYKGK 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y    E+Y+ + ++   ADG+  +     V  +EE+ YFF++S Y D++L+Y E +
Sbjct: 123 YKGLYCTPCESYWTERQL---ADGKCPDCGRE-VAEVEEDAYFFKMSHYADRVLAYIEEN 178

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           P+FI P+ RRNE+I+F+K GL+DL +SR +FDWGI +P  P +++YVW DALTNYLT  G
Sbjct: 179 PDFIQPVSRRNEMINFIKQGLEDLCISRTSFDWGIPVPIAPDHVIYVWFDALTNYLTPIG 238

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           +LD+P+  + K+WPAD+H++GK+I+RFH+I WP  L++ +LPLPK V+ HG+++  G+K+
Sbjct: 239 FLDDPEKFE-KYWPADVHLVGKEIVRFHSIIWPCILMALDLPLPKMVYGHGWLIVDGDKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV+DP+++I+E G DA+RYFL+REI  G+DG + +D L  R+NADLAN +GNL+ 
Sbjct: 298 SKSKGNVVDPVQLIDEFGADAIRYFLLREINLGQDGNFSRDALITRINADLANDLGNLLH 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++MI K  DG++      +E D + L+     +      M+   +  A+    + +S 
Sbjct: 358 RTLNMIGKFQDGVVEEARGESEIDRAFLADAESAIAAYEREMEEMKLQSAIKTTWAFISR 417

Query: 424 VDRYFDAQKPW---ELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
            ++Y D   PW   +         +  LY   E +R++++L++ F+P+ A KI+  L + 
Sbjct: 418 ANKYIDETMPWALAKDAAAKKQELTNTLYNLAESLRRISVLIEPFMPETAAKIWHQLGME 477

Query: 481 DENRCFQSLDQRLKPGFMLHK---TFDPIFPRF 510
            +    +  D R   GF+      + + +FPR 
Sbjct: 478 GDFSRVRFADVRTWGGFLAGTHVGSPEQLFPRI 510


>gi|322804348|emb|CBZ01898.1| methionyl-tRNA synthetase [Clostridium botulinum H04402 065]
          Length = 645

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 313/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T KV+VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKVYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYST 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKI 471


>gi|118445100|ref|YP_879163.1| methionyl-tRNA synthetase [Clostridium novyi NT]
 gi|118135556|gb|ABK62600.1| methionyl-tRNA synthetase [Clostridium novyi NT]
          Length = 646

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/470 (44%), Positives = 314/470 (66%), Gaps = 7/470 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+A+ HIG+ Y  + AD +ARF RL G D  F TGTDEHGQKI + A+  G
Sbjct: 6   FYITTPIYYPSAKLHIGNTYTTVAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEGKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K +VD+     +D+  V++ISYD FIRTT+  H +T + +++K+ DKGDIYKG Y G
Sbjct: 66  ITPKKYVDEIVAGIQDLWKVMNISYDKFIRTTDDYHVETVQKIFEKLYDKGDIYKGEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
            Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y D+L+ Y ESHP+F
Sbjct: 126 LYCTPCESFWTETQL---VDGKCPDCGR-PVEKTKEEAYFFKMSKYADRLIEYIESHPDF 181

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+++ F++ GL+DL +SR +FDWGI +  D ++++YVWIDAL+NY+T  GY 
Sbjct: 182 IQPESRKNEMLNNFLRPGLQDLCISRTSFDWGIPVSFDEKHVIYVWIDALSNYITALGYD 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
              D    K+WPA++H++GKDILRFH IYWP  L++ +LPLPK+VF HG++L  G K+SK
Sbjct: 242 QENDELYQKYWPANVHLVGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSK 301

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ ++ E G D +RY+L+ EI  G+DG Y  +   K+ N+DLAN +GNLV+R+
Sbjct: 302 SKGNVVDPVTLVNEFGTDPVRYYLLHEIPFGQDGMYTGETFIKKTNSDLANDLGNLVNRT 361

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           ++MI K +DG+IP P A  + D  ++ V     +++   M    I  AL ++ +LV   +
Sbjct: 362 IAMINKYFDGVIPAPKAEEDIDNDLIRVALEAPKKVEGKMDALKIPEALDEIWTLVRRSN 421

Query: 426 RYFDAQKPWELKKTNP--DRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +Y D   PW L K     +R  TVLY  VE +R ++++L AF+P+ + KI
Sbjct: 422 KYIDETMPWALAKEEDKRERLGTVLYNLVESLRIVSVMLSAFLPETSKKI 471


>gi|314932712|ref|ZP_07840082.1| methionine--tRNA ligase [Staphylococcus caprae C87]
 gi|313654542|gb|EFS18294.1| methionine--tRNA ligase [Staphylococcus caprae C87]
          Length = 657

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/524 (42%), Positives = 334/524 (63%), Gaps = 15/524 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  ++  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI +
Sbjct: 1   MMAKDTFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQE 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ AG T   ++D+     + + D L+IS DDFIRTTE+RH      +++++  +GDIY
Sbjct: 61  KAQKAGKTELEYLDEMIAGIKSLWDKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQ 173
            G Y GWYS+ DE YY +    D VY+  +   G+  ++ H  V+ ++EE YFF ++ Y 
Sbjct: 121 LGEYEGWYSVPDETYYTESQLVDPVYENGEIIGGKSPDSGHE-VELVKEESYFFNINKYT 179

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL +Y+ +P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWI
Sbjct: 180 DRLLEFYDENPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWI 239

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL NY+++ GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+
Sbjct: 240 DALVNYISSLGYLSDDEELFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFA 299

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N 
Sbjct: 300 HGWILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNY 359

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNLV+R++SMI K + G +P   G   E DE + ++    ++   ENM++    
Sbjct: 360 DLANDLGNLVNRTISMINKYFQGELPAYQGPKHELDEDMEAMALETVKNFNENMESLQFS 419

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKL 469
            AL+ V   +S  ++Y D  +PW L K     D    V+   VE IR  A+LLQ F+   
Sbjct: 420 VALSTVWKFISRTNKYIDETQPWVLAKDENQRDMLGNVMAHLVENIRFAAVLLQPFLTHA 479

Query: 470 ANKIFDILFVADENRC-FQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             ++F  L + D     F+SL+    L    ++ +   PIFPR 
Sbjct: 480 PREVFKQLNMNDPKLSQFESLESYGALTEPILVTEKPTPIFPRL 523


>gi|170758335|ref|YP_001785405.1| methionyl-tRNA synthetase [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405324|gb|ACA53735.1| methionine--tRNA ligase [Clostridium botulinum A3 str. Loch Maree]
          Length = 645

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 313/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAEKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +D+  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKAYVDEIVAGIKDLWKIMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNT 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 ENDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGADPVRYYLLREIPFGADGMFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ E+M+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEEDMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY  VE +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWVLAKDESKKERLGTVLYNLVESLRIISVCISAFIPETSIKI 471


>gi|126654257|ref|ZP_01726045.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp.
           B14905]
 gi|126589290|gb|EAZ83448.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp.
           B14905]
          Length = 658

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 332/518 (64%), Gaps = 12/518 (2%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           M E++K  YI+T I YP+ + HIG AY  + +D +AR+ RL G DV F TG DEHGQKI 
Sbjct: 1   MSEQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGYDVRFLTGMDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           + A  AG   + +V++ +   + +  ++DISYDDFI+TT++RH      +++K  D GDI
Sbjct: 61  EKAAEAGKHPQDYVNEIAEAAKKLWALMDISYDDFIQTTQERHTKAVEKIFQKFLDNGDI 120

Query: 120 YKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           YKG Y GWY    E+++ + ++    DG   +    PV  ++EE YFF +  Y D+LLSY
Sbjct: 121 YKGEYEGWYCTPCESFFTETQL---VDGNCPDCGR-PVHKVKEESYFFNMKKYADRLLSY 176

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE +  FI P  R+NE+I+ F+K GL+DLS+SR +FDWGIK+P DP++++YVW+DALTNY
Sbjct: 177 YEENLGFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKVPGDPKHVIYVWVDALTNY 236

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T+ GYL + +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKKVF+HGFI+ 
Sbjct: 237 ITSLGYLSDDETLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMM 296

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNVI P  +IE  G+DA RYFL+RE+  G DG +  +   +R N DLAN +
Sbjct: 297 KDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDL 356

Query: 359 GNLVSRSVSMILKDYDGMIPTPG-AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNL++R++SMI K YDG+IP+     TE D ++      V  +  E+M+       LA +
Sbjct: 357 GNLLNRTISMINKYYDGIIPSENLQSTEFDAALKEQAESVRIKYEESMEKMQFSVVLADL 416

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
            +LVS  ++Y D  +PW L K   D+    +V+    E + Q+A++LQ F+  +  ++ +
Sbjct: 417 WTLVSRTNKYIDETQPWVLAKEEADKPKLGSVMRNLAESLHQIAVMLQPFMTTIPKRMME 476

Query: 476 ILFVADENRCFQSLD---QRLKPGFMLHKTFDPIFPRF 510
            L + D+   + +++     +     + +   PIFPR 
Sbjct: 477 QLGLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRL 514


>gi|95930673|ref|ZP_01313407.1| methionyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684]
 gi|95133325|gb|EAT14990.1| methionyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684]
          Length = 510

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/509 (42%), Positives = 315/509 (61%), Gaps = 9/509 (1%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +  YI+T I Y N  PHIGHAY  +  DVLAR+ +  G +V F TGTDEHGQK+ KAA  
Sbjct: 3   KTFYITTPIYYVNDVPHIGHAYTTLACDVLARYKKARGYEVFFLTGTDEHGQKVEKAAIA 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AG T     D+  + F  +   L+I   DFIRTT++RH +  + ++ +I ++GDIY G Y
Sbjct: 63  AGETPLELADRVMQRFAALWQKLNIDNTDFIRTTQQRHKEGVQKMFTQIQEQGDIYLGAY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
             WY    E ++ + ++  G           P   ++EE YFFR+S YQ +LL + E++P
Sbjct: 123 EDWYCTPCETFWTETQLIDGCCPDC----GRPTDKLKEESYFFRMSKYQQQLLDHIEANP 178

Query: 185 EFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGY 244
           +FI P  RRNEV+SFV+ GL+DLS+SR +F WGI +P D ++++YVW DAL NY+T  GY
Sbjct: 179 DFIQPRSRRNEVLSFVREGLRDLSISRTSFSWGIPVPGDDKHVIYVWFDALNNYITALGY 238

Query: 245 LDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKIS 304
            D+  G+  KFWP  +HVIGKDILRFH +YWP FL++A LPLP+KVF+HG+   +G+K+S
Sbjct: 239 PDDKQGTFEKFWPCSVHVIGKDILRFHTVYWPTFLMAAGLPLPEKVFAHGWWTVEGKKMS 298

Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364
           KSL NV++P  +++  G+D +RYFL+RE+  G DG +    L  R+N+DLAN +GNLVSR
Sbjct: 299 KSLQNVVEPNMLVDTYGIDPIRYFLLREVPFGLDGDFSHSALIHRINSDLANDLGNLVSR 358

Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV 424
           S +M+ K + G +P P A  + D+  +      L+ I + M +   ++AL  +  L+S  
Sbjct: 359 STAMLNKYFGGTLPEPTAMADIDQPFIDQFPAKLELIDKQMNDLAFNKALLSIWELISSA 418

Query: 425 DRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           ++Y D   PW L K     +R  TV+Y  +E +R + +++  F+P    +I +IL    +
Sbjct: 419 NKYIDDTAPWGLAKDEAQKERLGTVMYNLLEAVRLIGLMVAPFLPDTGKRIMEILGQDSD 478

Query: 483 NRCFQSLDQ--RLKPGFMLHKTFDPIFPR 509
           N      DQ   L+ G  + K   P+FPR
Sbjct: 479 NLMLDGQDQWGGLQAGTTIEKA-PPMFPR 506


>gi|291288265|ref|YP_003505081.1| methionyl-tRNA synthetase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885425|gb|ADD69125.1| methionyl-tRNA synthetase [Denitrovibrio acetiphilus DSM 12809]
          Length = 644

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 213/478 (44%), Positives = 305/478 (63%), Gaps = 6/478 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I Y N  PHIGHAY  +  D ++R+ RL G DV F TGTDEHGQKI +AAQ  G
Sbjct: 6   FYVTTPIYYVNDVPHIGHAYTTVACDTISRYKRLCGFDVCFLTGTDEHGQKIEQAAQKRG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K   D+  + F  +  +L+IS D FIRTT++ H    R ++ K+ + GDIY   Y G
Sbjct: 66  ITPKALADEVVQRFAGLWKILNISNDKFIRTTDELHKKAVRKIFDKMKENGDIYLDHYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
           WY    E Y  + ++    DG    +       ++E  YFFR+S Y D+LL + E + +F
Sbjct: 126 WYCTPCETYLTETQLL---DGNCCPSCGRETAKLKEPSYFFRMSKYADQLLKHIEDNKDF 182

Query: 187 ILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
           + P  RRNE+ISF+K GL+DLS+SR TF WGI +PD P++++YVWIDALTNY+   GY +
Sbjct: 183 VRPESRRNEIISFIKDGLRDLSVSRVTFKWGIPVPDAPEHVIYVWIDALTNYIAALGYGE 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
           + D    KFWPAD HV+GKDILRFH +YWP  L+SA LPLPK VF+HG+   +G+K+SKS
Sbjct: 243 D-DADFQKFWPADYHVVGKDILRFHTVYWPTMLMSAGLPLPKSVFAHGWWTVEGQKMSKS 301

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
           LGN IDP  ++++ GVD++RYFL+RE+  G DG +    L  R+N DLAN +GNL++R++
Sbjct: 302 LGNAIDPAWLVDKFGVDSIRYFLLREVPFGLDGDFSFKALIHRINGDLANDLGNLLNRTM 361

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
            M+ + +DG++P      + D+ +     RV +E+ E++ N   ++AL     LVS +++
Sbjct: 362 GMVNRYFDGVVPAYTEAGDEDKPLEETIERVFREVDEHITNMAFNKALMTTWELVSALNK 421

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADE 482
           Y D   PW L K  T   R  +VLY  ++ IR +++LL  F+P+ A K+   L  A E
Sbjct: 422 YIDETAPWALAKDETRKGRLGSVLYSVLDGIRLVSLLLYPFMPETAVKMRRQLGTAQE 479


>gi|289450466|ref|YP_003475749.1| methionine--tRNA ligase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185013|gb|ADC91438.1| methionine--tRNA ligase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 672

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/512 (42%), Positives = 321/512 (62%), Gaps = 12/512 (2%)

Query: 5   EKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64
           +K YIST I Y +   HIGH+Y  + AD +AR+ R+ G DV F TGTDEHG+KI + A+ 
Sbjct: 3   KKFYISTPIYYTSGNLHIGHSYSTVAADAMARYKRMAGNDVFFLTGTDEHGEKIQERAEA 62

Query: 65  AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124
           AG T + FVD+     +D+  + +ISYD FIRTT+  H    + + +K+ D+GDIYK  Y
Sbjct: 63  AGKTPQAFVDELVSGIKDLWKLFNISYDKFIRTTDAEHMAGVKYIVQKLYDRGDIYKSEY 122

Query: 125 SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHP 184
            GWY    EA++ + ++  G           PV   +EE YFFRLS Y D+L+  +E HP
Sbjct: 123 EGWYCTPCEAFWTESQLKDGCCPDC----GRPVHKTKEESYFFRLSKYNDRLIKLFEEHP 178

Query: 185 EFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           EF+ P  R NE+++ F++ GL+DL++SR +FDWGIK+P DP++++YVWIDAL+NY+T  G
Sbjct: 179 EFVQPESRANEMLNNFLRPGLQDLAISRTSFDWGIKVPFDPKHVVYVWIDALSNYITALG 238

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y +N      KFWPAD+H++GK+I+RFH I WPA L++ +LPLPK+V+ HG+IL K  K+
Sbjct: 239 YPEN-TAKFEKFWPADVHLVGKEIVRFHTIIWPALLMALDLPLPKQVYGHGWILFKEGKM 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GN++DP+ +     VDA+RYFL+RE+  G DG Y  + L  R+N+DLAN +GNL+S
Sbjct: 298 SKSKGNIVDPVVLCNRYTVDAIRYFLLREVPFGADGSYSNEALITRINSDLANDLGNLMS 357

Query: 364 RSVSMILKDYDGMIP--TPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421
           R+++MI K + G +P  TP   +E DE +    S V       M       AL +V  L+
Sbjct: 358 RTIAMICKYFAGKLPPATPSINSE-DERLRETASEVAASYVSYMDKMQFSLALGEVWRLI 416

Query: 422 SEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479
            + ++Y D   PW L K  T  +R + VL    EV+R ++I +  F+P+ A K+   L +
Sbjct: 417 GQANKYIDVTMPWLLAKDPTKQERLAAVLCNLGEVLRLVSIYIAPFMPETAEKMQAALHL 476

Query: 480 ADENRCFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
            +  + F SL++  L        T +P+FPR 
Sbjct: 477 TEAQKAFSSLNRFDLFATEQPLSTCEPLFPRL 508


>gi|315640002|ref|ZP_07895129.1| methionine--tRNA ligase [Enterococcus italicus DSM 15952]
 gi|315484264|gb|EFU74733.1| methionine--tRNA ligase [Enterococcus italicus DSM 15952]
          Length = 669

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/521 (42%), Positives = 327/521 (62%), Gaps = 11/521 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E+E  YI+T I YP+ + HIG++Y  I  D +AR+ RL G DV + TG DEHGQKI K
Sbjct: 1   MAEKETFYITTPIYYPSGKLHIGNSYTTIACDAVARYKRLMGFDVFYLTGVDEHGQKIEK 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A   GVT + +VD+ + + + +   LDISYD FIRTT+  H    + +++++ D+GDIY
Sbjct: 61  KADELGVTPQEYVDKMAADVQKLWKTLDISYDKFIRTTDDYHQKAVKKIFQQLLDQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDD---EVYKGADGQYYNAQH---NPVQWMEEEGYFFRLSAYQD 174
            G Y GWYS+ DE Y+ +    EVYK  +G     +    + V+ ++EE YFFR+S Y D
Sbjct: 121 LGQYEGWYSISDEEYFTETQLAEVYKDEEGNVIGGKAPSGHEVELVKEESYFFRMSKYAD 180

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL+YY+ HPEFI P  R+NE+I+ F+K GL+DL++SR T  WGI +  +P++++YVWID
Sbjct: 181 RLLAYYDEHPEFIQPESRKNEMINNFIKPGLEDLAVSRTTHSWGIPVDANPKHVVYVWID 240

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL+NY++  GY  + D    K+WPAD+H++GK+I+RFH IYWP  L++  LPLPK+V+ H
Sbjct: 241 ALSNYISALGYGSDDDQLFQKYWPADVHMVGKEIVRFHTIYWPIMLMALGLPLPKEVYGH 300

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G++L K  K+SKS GNV+ P  ++E  G+DALRY+L+R +  G DG +  +    RVN D
Sbjct: 301 GWLLMKEGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAVPFGSDGVFTPEDFVARVNYD 360

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNL++R+V+MI K  DG++PT     T  D  + +  + V+   RE M N     
Sbjct: 361 LANDLGNLLNRTVAMINKYCDGIVPTYRSKVTPFDSELSTTAANVIGRYREAMDNMEFST 420

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS--TVLYVTVEVIRQLAILLQAFVPKLA 470
           ALA+V +LVS  ++Y D  +PW L K    +A   +V+    E +R +A+LLQ  + +  
Sbjct: 421 ALAEVWTLVSRANKYIDETQPWILAKDEEKKAELDSVMIHLAESLRIVALLLQPVMTETP 480

Query: 471 NKIFDILFVADENRCFQSLDQRLKPG-FMLHKTFDPIFPRF 510
            KIF+ L +         L     P    + +   PIFPR 
Sbjct: 481 AKIFEQLGLKQMATSLTDLRFGEFPAETKVVEKGTPIFPRL 521


>gi|187777332|ref|ZP_02993805.1| hypothetical protein CLOSPO_00884 [Clostridium sporogenes ATCC
           15579]
 gi|187774260|gb|EDU38062.1| hypothetical protein CLOSPO_00884 [Clostridium sporogenes ATCC
           15579]
          Length = 645

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 310/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+  GV
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKGV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +D+  +++I YD FIRTT+  H +  + ++K + DKGDIYK  Y GW
Sbjct: 67  TPKAYVDEIVAGIKDLWKMMNIDYDKFIRTTDDYHVELVQKIFKTLCDKGDIYKSEYEGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++ +G           PV+  +EE YFF++S Y  KL+ Y ESHP+FI
Sbjct: 127 YCTPCESFWTETQLVEGKCPDC----GRPVEKAKEEAYFFKMSKYAPKLIEYIESHPDFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+I+ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMINNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNT 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    ++WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKRYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGMFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPEGNCKEDIDEDLIKLALETPRKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY  VE +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLVESLRIISVCISAFIPETSIKI 471


>gi|222152165|ref|YP_002561325.1| methionyl-tRNA synthetase [Macrococcus caseolyticus JCSC5402]
 gi|222121294|dbj|BAH18629.1| methionyl-tRNA synthetase [Macrococcus caseolyticus JCSC5402]
          Length = 654

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 222/517 (42%), Positives = 333/517 (64%), Gaps = 14/517 (2%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            Y++T I YP+ + HIGHAY  +  D +AR+ R+ G DV + TGTDEHGQKI + AQ AG
Sbjct: 6   FYVTTPIYYPSGKLHIGHAYSTVAGDAIARYKRMQGYDVKYLTGTDEHGQKIQEKAQAAG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
            +   ++D+   + + +   LDIS DDFIRTTE RH      +++++ ++GDIY G Y G
Sbjct: 66  KSEIEYLDEIIADIQALWKKLDISNDDFIRTTEDRHKVVVEKIFERLLEQGDIYLGDYEG 125

Query: 127 WYSLRDEAYYND----DEVYKG---ADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           WYS+ DE +Y +    D +Y+G     G+  ++ H PVQ ++EE YFF+LS Y D+L+ Y
Sbjct: 126 WYSVPDETFYTETQLVDPIYEGEKIVGGKSPDSGH-PVQLVKEESYFFKLSKYTDRLIEY 184

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           Y++HPEFILP+ R+NE+++ F+K GL+DL++SR +FDWGIK+P +P++++YVWIDALTNY
Sbjct: 185 YDAHPEFILPVSRKNEMLNNFIKPGLEDLAVSRTSFDWGIKVPSNPKHVVYVWIDALTNY 244

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           ++  GYL   +    K+WPAD+H++ K+I+RFH I WPA L++ +LPLPKK+F+HG+IL 
Sbjct: 245 ISALGYLSEDETEFNKYWPADVHIMAKEIVRFHTIIWPALLMALDLPLPKKIFAHGWILM 304

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNV+DP  +I+  G+DA+RY+L+RE+  G DG +  +   +R N DLAN +
Sbjct: 305 KDGKMSKSKGNVVDPHVLIDRYGLDAVRYYLMRELPFGSDGVFTPEAFVERTNFDLANDL 364

Query: 359 GNLVSRSVSMILKDYDG-MIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNLV+R+++MI K +DG +    G     D  I  +     +     M++     AL +V
Sbjct: 365 GNLVNRTIAMINKYFDGNLTGYKGQMHAVDAEIEDLAVATKKAYDNAMESMQYSVALQEV 424

Query: 418 ISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
             L+S  ++Y D   PW L K  +  +   +V+Y  VE IR  A+LL+ F+ +   KIF+
Sbjct: 425 WKLISRTNKYIDETTPWILIKDASQKELLESVMYHLVENIRFAAVLLRPFLTEAPYKIFE 484

Query: 476 ILFVADEN-RCFQSLDQRLKPG-FMLHKTFDPIFPRF 510
            L + D     F SL+   +     + +   PIFPR 
Sbjct: 485 QLNLKDNALYGFDSLNTYGQIAELKVVEKATPIFPRL 521


>gi|299536738|ref|ZP_07050048.1| methionyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
 gi|298727852|gb|EFI68417.1| methionyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
          Length = 658

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 328/518 (63%), Gaps = 12/518 (2%)

Query: 1   MKEREK-LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA 59
           M E++K  YI+T I YP+ + HIG AY  + +D +AR+ RL G DV F TG DEHGQKI 
Sbjct: 1   MSEQQKTFYITTPIYYPSGKFHIGTAYTTVASDTIARYKRLKGYDVRFLTGMDEHGQKIQ 60

Query: 60  KAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDI 119
           + A  AG   + +V++ +   + +  ++DISYDDFI+TT+ RH      +++K  D GDI
Sbjct: 61  EKAAEAGKHPQDYVNEIADAAKKLWGLMDISYDDFIQTTQDRHTKAVEKIFQKFLDNGDI 120

Query: 120 YKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179
           YKG Y GWY    E+++ + ++    DG   +    PV  ++EE YFF +  Y D+LL+Y
Sbjct: 121 YKGEYEGWYCTPCESFFTETQL---VDGNCPDCGR-PVHKVKEESYFFNMKKYADRLLAY 176

Query: 180 YESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNY 238
           YE + EFI P  R+NE+I+ F+K GL+DLS+SR +FDWGIK+P DP++++YVW+DALTNY
Sbjct: 177 YEENLEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKVPGDPKHVIYVWVDALTNY 236

Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILH 298
           +T  GYL   +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKKVF+HGFI+ 
Sbjct: 237 ITALGYLSEDESLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMM 296

Query: 299 KGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGI 358
           K  K+SKS GNVI P  +IE  G+DA RYFL+RE+  G DG +  +   +R N DLAN +
Sbjct: 297 KDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDL 356

Query: 359 GNLVSRSVSMILKDYDGMIPTPG-AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQV 417
           GNL++R++SMI K +DG+IPT     TE D ++      V  +  E+M+       LA +
Sbjct: 357 GNLLNRTISMINKYFDGIIPTENLQPTEFDAALKEQAESVRIKYEESMEKMQFSVVLADL 416

Query: 418 ISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFD 475
            +LVS  ++Y D  +PW L K   D+     V+    E + Q+A++LQ F+     ++ D
Sbjct: 417 WTLVSRTNKYIDETQPWVLAKEESDKPKLGAVMRNLAESLHQIAVMLQPFMTTTPKRMID 476

Query: 476 ILFVADENRCFQSLD---QRLKPGFMLHKTFDPIFPRF 510
            L + D+   + +++     +     + +   PIFPR 
Sbjct: 477 QLGLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRL 514


>gi|329929628|ref|ZP_08283327.1| methionine--tRNA ligase [Paenibacillus sp. HGF5]
 gi|328936005|gb|EGG32459.1| methionine--tRNA ligase [Paenibacillus sp. HGF5]
          Length = 662

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/517 (42%), Positives = 330/517 (63%), Gaps = 12/517 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +++  YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI +
Sbjct: 1   MADKKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIER 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A  AG T + FVD      +D+   LDIS +DFIRTTEKRH    + +++++  + DIY
Sbjct: 61  KAAEAGKTPQQFVDDIVAGIKDLWKKLDISNEDFIRTTEKRHTTVVQEVFERLLKQDDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y GWY    E+++ + ++  G           PV+ ++EE YFFR+S Y D+LL YY
Sbjct: 121 KGEYEGWYCTPCESFFLERQLVNGNCPDC----GRPVELVKEESYFFRMSKYVDRLLQYY 176

Query: 181 ESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           E +P+FI P+ R+NE+I+ F+K GL+DL++SR T++WG+K+  DP++++YVWIDAL NY+
Sbjct: 177 EENPDFIQPVSRKNEMINNFIKPGLEDLAVSRTTYEWGVKVKSDPKHVIYVWIDALLNYI 236

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T  GY         K+WPAD+H++ K+I+RFH IYWP  L++ ++PLPKKVF+HG++L K
Sbjct: 237 TALGYGTEDTSLYDKYWPADVHLMSKEIVRFHTIYWPIILMALDVPLPKKVFAHGWLLMK 296

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
             K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +RVN+DLAN +G
Sbjct: 297 DGKMSKSKGNVVDPVTMIDRYGLDALRYYLLREVPFGADGTFTPESFVERVNSDLANDLG 356

Query: 360 NLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           NL++R+V+M+ K +DG +P      T  D +I      V  ++   M+N     AL  + 
Sbjct: 357 NLLNRTVAMVDKYFDGEVPAFSAGVTPFDAAIEEAAKSVYDKVETAMENMEFSVALTAIS 416

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
             VS  ++Y D  +PW L K    R   ++V+   VE +R  +ILLQ F+ +   K+++ 
Sbjct: 417 QFVSRSNKYIDETQPWTLAKDESKRHELASVMSHLVETLRIASILLQPFLTRTPKKMWEQ 476

Query: 477 LFVAD-ENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           L +A+ E   ++S  Q   +  G  L K  +PIFPR 
Sbjct: 477 LGLAEGELTTWESGRQLGAIPAGTKLQKG-EPIFPRL 512


>gi|168177409|ref|ZP_02612073.1| methionyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
 gi|182670464|gb|EDT82438.1| methionyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
          Length = 645

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 312/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYST 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKI 471


>gi|331270594|ref|YP_004397086.1| methionyl-tRNA synthetase [Clostridium botulinum BKT015925]
 gi|329127144|gb|AEB77089.1| methionyl-tRNA synthetase [Clostridium botulinum BKT015925]
          Length = 646

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 314/470 (66%), Gaps = 7/470 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+A+ HIG+ Y  + AD +ARF RL G D  F TGTDEHGQKI + A+  G
Sbjct: 6   FYITTPIYYPSAKLHIGNTYTTVAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEAKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K +VD+     +D+  V++++YD FIRTT+  H +T + ++KK+ D+GDIYKG Y G
Sbjct: 66  ITPKEYVDEIVAGIKDLWKVMNVNYDKFIRTTDDYHVETVQKIFKKLYDQGDIYKGEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
            Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y D+L+ Y E HPEF
Sbjct: 126 LYCTPCESFWTETQL---VDGKCPDCGR-PVEKTKEEAYFFKMSKYADRLIKYIEYHPEF 181

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+++ F++ GL+DL +SR +F+WGI +  D ++++YVWIDALTNY+T  GY 
Sbjct: 182 IQPESRKNEMLNNFLRPGLQDLCISRTSFNWGIPVSFDEKHVIYVWIDALTNYITALGYN 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            + D    K+WPA++H++GKDILRFH IYWP  L++ +LPLPK+VF HG++L  G K+SK
Sbjct: 242 QDNDELYQKYWPANVHLVGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSK 301

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ ++   G DA+RY+L+ EI  G+DG Y  +   K+ N+DLAN +GNLV+R+
Sbjct: 302 SKGNVVDPVTLVNHFGTDAVRYYLLHEIPFGQDGMYTSETFIKKTNSDLANDLGNLVNRT 361

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           ++MI K +DG+IP P A  + D+ ++ +      ++   M    I  AL ++ +LV   +
Sbjct: 362 IAMINKYFDGIIPVPTAKDDIDDELIKIALEAPGKVEAKMDELKIPEALDKIWTLVRRSN 421

Query: 426 RYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +Y D   PW L K     +R  TVLY  VE +R ++++L AF+P+ + KI
Sbjct: 422 KYIDETMPWALAKEEDKKERLGTVLYNLVESLRIVSVMLSAFLPETSKKI 471


>gi|168182315|ref|ZP_02616979.1| methionine--tRNA ligase [Clostridium botulinum Bf]
 gi|237793393|ref|YP_002860945.1| methionyl-tRNA synthetase [Clostridium botulinum Ba4 str. 657]
 gi|182674668|gb|EDT86629.1| methionine--tRNA ligase [Clostridium botulinum Bf]
 gi|229262065|gb|ACQ53098.1| methionine--tRNA ligase [Clostridium botulinum Ba4 str. 657]
          Length = 645

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 312/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCISRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYST 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKI 471


>gi|261405922|ref|YP_003242163.1| methionyl-tRNA synthetase [Paenibacillus sp. Y412MC10]
 gi|261282385|gb|ACX64356.1| methionyl-tRNA synthetase [Paenibacillus sp. Y412MC10]
          Length = 662

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/517 (42%), Positives = 330/517 (63%), Gaps = 12/517 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M +++  YI+T I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI +
Sbjct: 1   MADKKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIER 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A  AG T + FVD      +D+   LDIS +DFIRTTEKRH    + +++++  + DIY
Sbjct: 61  KAAEAGKTPQQFVDDIVAGIKDLWKKLDISNEDFIRTTEKRHTTVVQDVFERLLKQDDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           KG Y GWY    E+++ + ++  G           PV+ ++EE YFFR+S Y D+LL YY
Sbjct: 121 KGEYEGWYCTPCESFFLERQLVNGNCPDC----GRPVELVKEESYFFRMSKYVDRLLQYY 176

Query: 181 ESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           E +P+FI P+ R+NE+I+ F+K GL+DL++SR T++WG+K+  DP++++YVWIDAL NY+
Sbjct: 177 EENPDFIQPVSRKNEMINNFIKPGLEDLAVSRTTYEWGVKVKSDPKHVIYVWIDALLNYI 236

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T  GY         K+WPAD+H++ K+I+RFH IYWP  L++ ++PLPKKVF+HG++L K
Sbjct: 237 TALGYGTEDTSLYDKYWPADVHLMSKEIVRFHTIYWPIILMALDVPLPKKVFAHGWLLMK 296

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
             K+SKS GNV+DP+ +I+  G+DALRY+L+RE+  G DG +  +   +RVN+DLAN +G
Sbjct: 297 DGKMSKSKGNVVDPVTMIDRYGLDALRYYLLREVPFGADGTFTPESFVERVNSDLANDLG 356

Query: 360 NLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVI 418
           NL++R+V+M+ K +DG +P      T  D +I      V  ++   M+N     AL  + 
Sbjct: 357 NLLNRTVAMVDKYFDGEVPAFSAGVTPFDAAIEEAAKSVYDKVETAMENMEFSVALTAIS 416

Query: 419 SLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLANKIFDI 476
             VS  ++Y D  +PW L K    R   ++V+   VE +R  +ILLQ F+ +   K+++ 
Sbjct: 417 QFVSRSNKYIDETQPWTLAKDESKRHELASVMSHLVEALRIASILLQPFLTRTPKKMWEQ 476

Query: 477 LFVAD-ENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           L +A+ E   ++S  Q   +  G  L K  +PIFPR 
Sbjct: 477 LGLAEGELTTWESGRQLGAIPAGTKLQKG-EPIFPRL 512


>gi|226947300|ref|YP_002802391.1| methionine--tRNA ligase [Clostridium botulinum A2 str. Kyoto]
 gi|226841497|gb|ACO84163.1| methionine--tRNA ligase [Clostridium botulinum A2 str. Kyoto]
          Length = 645

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 312/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNT 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKI 471


>gi|291166390|gb|EFE28436.1| methionine--tRNA ligase [Filifactor alocis ATCC 35896]
          Length = 642

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 322/489 (65%), Gaps = 8/489 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  Y++T I YP+ + HIGH Y  + AD ++R+ R  G DV F TGTDEHG+KI K A+
Sbjct: 3   KKTFYVTTPIYYPSGRLHIGHTYTTVAADAISRYKRFAGFDVRFLTGTDEHGEKIQKKAR 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G+   +++D    + + + +V++ISYDDFIRTTE RH +  + +++K+ D+GDIY G 
Sbjct: 63  EMGLEPIIYLDNMISDIKKLWNVMEISYDDFIRTTESRHEERVQKIFQKLYDQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y G Y +  EA++ + ++    D +  +  H  V+  +E+ YFFRLS YQD+L+ YYE H
Sbjct: 123 YEGHYCVECEAFWTESQL---EDNKCPDC-HREVESKKEQSYFFRLSKYQDRLIEYYEQH 178

Query: 184 PEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTT 242
           P+F  P  R+NE+++ F+K GL+DLS+SR +FDWG+K+P D ++++YVWIDAL NY+T  
Sbjct: 179 PDFCFPESRKNEMLNNFLKKGLEDLSVSRTSFDWGVKVPFDERHVIYVWIDALCNYITAL 238

Query: 243 GYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302
           GY DN    +A +WPA++ ++GK+I+RFH I WPA L++ +LPLP+KV+ HG+IL   +K
Sbjct: 239 GYPDNTKEMQA-YWPANMQIVGKEIMRFHTIIWPALLMALDLPLPQKVYGHGWILFSDDK 297

Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLV 362
           +SKS GNV+ P  +IE  G+DAL+YFL+RE   G+DG Y   G   R+N+DL N +GNL+
Sbjct: 298 MSKSKGNVVYPEPIIERYGIDALKYFLLREFVFGQDGNYTNRGFLTRINSDLVNDLGNLL 357

Query: 363 SRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVS 422
           SR+VSM+ K  DG++    A TE DES+ ++ + + ++  E M+N   + A  ++  LV 
Sbjct: 358 SRTVSMVEKYTDGIVMEYNASTEFDESLETIINELFEKFDEAMENMQFNEAFEELWKLVR 417

Query: 423 EVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
             ++Y D   PW+L K  T  +   +VLY  +E +R +A+ L+  +   ++KI + + + 
Sbjct: 418 RANKYIDETMPWKLAKDDTKQEELRSVLYHLIETLRVVAVFLRPMLTITSDKILEQINIP 477

Query: 481 DENRCFQSL 489
            E     S+
Sbjct: 478 VEEATLDSV 486


>gi|169825668|ref|YP_001695826.1| methionyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
 gi|168990156|gb|ACA37696.1| Methionyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
          Length = 663

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/516 (42%), Positives = 331/516 (64%), Gaps = 11/516 (2%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           ++++  YI+T I YP+ + HIG AY  + +D +AR+ RL G DV F TG DEHGQKI + 
Sbjct: 8   EQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGYDVRFLTGMDEHGQKIQEK 67

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A  AG   + +V++ + + + +  ++DI+YDDFI+TT++RH      +++K  D GDIYK
Sbjct: 68  AAEAGKHPQDYVNEIAESAKKLWALMDITYDDFIQTTQERHTKAVEKIFQKFLDNGDIYK 127

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYE 181
           G Y GWY    E+++ + ++    DG   +    PV  ++EE YFF +  Y D+LL+YYE
Sbjct: 128 GEYEGWYCTPCESFFTETQL---VDGNCPDCGR-PVHKVKEESYFFNMKKYADRLLAYYE 183

Query: 182 SHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
            + EFI P  R+NE+I+ F+K GL+DLS+SR +FDWGIK+P D ++++YVW+DALTNY+T
Sbjct: 184 ENLEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKVPGDAKHVIYVWVDALTNYIT 243

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
           + GYL + +    K+WPAD+HV+GKDI+RFH IYWP FL++ +LPLPKKVF+HGFI+ K 
Sbjct: 244 SLGYLSDDETLFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKD 303

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKS GNVI P  +IE  G+DA RYFL+RE+  G DG +  +   +R N DLAN +GN
Sbjct: 304 GKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDLGN 363

Query: 361 LVSRSVSMILKDYDGMIPTPG-AFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           L++R++SMI K +DG+IP+     TE D ++      V  +  E+M+       LA + +
Sbjct: 364 LLNRTISMINKYFDGIIPSENLQSTEFDAALKEQAESVRIKYEESMEKMQFSVVLADLWT 423

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           LVS  ++Y D  +PW L K   D+    TV+    E + Q+A++LQ F+     ++ + L
Sbjct: 424 LVSRTNKYIDETQPWVLAKEEADKPKLGTVMRNLAESLHQIAVMLQPFMTTTPKRMMEQL 483

Query: 478 FVADENRCFQSLD---QRLKPGFMLHKTFDPIFPRF 510
            + D+   + +++     +     + +   PIFPR 
Sbjct: 484 GLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRL 519


>gi|82750197|ref|YP_415938.1| methionyl-tRNA synthetase [Staphylococcus aureus RF122]
 gi|82655728|emb|CAI80127.1| ethionyl-tRNA synthetase [Staphylococcus aureus RF122]
          Length = 657

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 329/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY+++ GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISSLGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKPIFPRL 522


>gi|163791030|ref|ZP_02185451.1| methionyl-tRNA synthetase [Carnobacterium sp. AT7]
 gi|159873675|gb|EDP67758.1| methionyl-tRNA synthetase [Carnobacterium sp. AT7]
          Length = 675

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/523 (41%), Positives = 326/523 (62%), Gaps = 13/523 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E++  YI+T I YP+ + HIG+AY  I  DV+AR+ R+   DV + TG+DEHGQKI  
Sbjct: 1   MTEKKTFYITTPIYYPSGKLHIGNAYSTIACDVMARYKRMQDFDVFYLTGSDEHGQKIEN 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ   +T + +VD+ ++  +++ ++L+IS D FIRTT+  H      ++++   +GDIY
Sbjct: 61  KAQELNITPQEYVDEMAKGMQNLWELLEISNDKFIRTTDPIHEKVVADIFERFLAQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQ 173
              Y GWYS+ DE +Y + +   V + A+G     +     +PV+ ++EE YFFR+S Y 
Sbjct: 121 LDEYEGWYSVPDETFYTETQLVDVERDAEGTIIGGKSPDSGHPVELIKEESYFFRMSKYA 180

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL+YY  HP+FI P  R+NE+I+ F+K GL+DL++SR TF WG+K+P +P++++YVWI
Sbjct: 181 DRLLAYYNEHPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFTWGVKVPSNPKHVIYVWI 240

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL NY+T  GY  +      KFWPAD+H++GK+I+RFH IYWP  L++ +LPLPKK+F 
Sbjct: 241 DALANYITALGYGTDDTSLFDKFWPADVHMVGKEIVRFHTIYWPIMLMALDLPLPKKIFG 300

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG++L K  K+SKS GNV+ P  ++E+ G+DALRY+L+RE+  G DG +  +    RVN 
Sbjct: 301 HGWLLMKEGKMSKSKGNVVYPEMLVEQYGLDALRYYLMREVTFGSDGVFTPEDFVSRVNY 360

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNL++R+++MI K +DG +P   G  TE D  +     +V    +E M+N    
Sbjct: 361 DLANDLGNLLNRTIAMINKYFDGKVPDYTGNVTEFDAVLKETAEKVCTNYQEEMENMQFS 420

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKL 469
            AL+ V  L+S  ++Y D   PW+L K     +  ++V+    E +R  AILLQ F+   
Sbjct: 421 SALSHVWVLISRANKYIDETAPWKLAKEEDQKNELASVMVHLAETLRISAILLQPFLTHA 480

Query: 470 ANKIFDILFVADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             ++F  L V  E     S  Q         + K   PIFPR 
Sbjct: 481 PKEVFAQLGVEGEFAGDWSTIQFGSFPTNTTVIKKGTPIFPRL 523


>gi|148378083|ref|YP_001252624.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502]
 gi|153931420|ref|YP_001382482.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397]
 gi|153936823|ref|YP_001386034.1| methionyl-tRNA synthetase [Clostridium botulinum A str. Hall]
 gi|148287567|emb|CAL81631.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502]
 gi|152927464|gb|ABS32964.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397]
 gi|152932737|gb|ABS38236.1| methionine--tRNA ligase [Clostridium botulinum A str. Hall]
          Length = 645

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 313/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T KV+VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKVYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +   + V+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGRS-VEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYST 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM+   I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKI 471


>gi|253575851|ref|ZP_04853186.1| methionyl-tRNA synthetase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251844894|gb|EES72907.1| methionyl-tRNA synthetase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 673

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 221/524 (42%), Positives = 328/524 (62%), Gaps = 15/524 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +   YI++ I YP+ + HIGHAY  +  D +AR+ RL G DV + TGTDEHGQKI +
Sbjct: 1   MSNKPTFYITSPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIEQ 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A+  G T + FVD      + + + LDISYDDFIRTTE RH      ++ ++  +GDIY
Sbjct: 61  KAKEKGQTPQQFVDGIVAGIKQLWEKLDISYDDFIRTTEPRHKQVVEAIFDRLLKQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDE---VYKGADGQYYNAQH----NPVQWMEEEGYFFRLSAYQ 173
           KG Y GWYS+ DE YY + +   V +   G+    +     + V+ ++EE YFFR+S Y 
Sbjct: 121 KGEYEGWYSIPDETYYTESQLVDVIRNEKGEVIGGKSPESGHAVELVKEECYFFRMSKYV 180

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL +YE +P+FI P  R+NE+I+ F+K GL+DL++SR TFDWG+K+  DP++++YVWI
Sbjct: 181 DRLLKFYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVKGDPKHVVYVWI 240

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL+NY+T  GY  +      ++WPAD+H++GK+I+RFH IYWP  L++  LPLPKKVF 
Sbjct: 241 DALSNYITALGYGTDNQELFERYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFG 300

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG++L KG K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +RVN+
Sbjct: 301 HGWLLMKGGKMSKSKGNVVDPNVLIDRYGLDATRYYLLREVPFGSDGSFTPESFVQRVNS 360

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPT--PGAFTESDESILSVCSRVLQEIRENMQNQLI 410
           DLAN +GNL++R+V+M+ K + G +P   P A T  D  +       ++++ E M+N   
Sbjct: 361 DLANDLGNLLNRTVAMMEKYFGGEVPAYEPNA-TAFDAELEQAALDTVRKVEEVMENMGF 419

Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPK 468
             AL  + + +S  ++Y D  +PW L K    +   ++V+    E +R  +ILLQ F+ +
Sbjct: 420 SVALTHIGAFISRTNKYIDETQPWVLAKDEAKKGELASVMAHLAESLRIASILLQPFLTQ 479

Query: 469 LANKIFDILFVA-DENRCFQSLDQ-RLKPGFMLHKTFDPIFPRF 510
              KI+  L +A  E   ++S     L P        +PIFPR 
Sbjct: 480 APAKIWAQLGIAPGELTTWESAKTFGLIPAGTKLVKGEPIFPRL 523


>gi|325288365|ref|YP_004264546.1| methionyl-tRNA synthetase [Syntrophobotulus glycolicus DSM 8271]
 gi|324963766|gb|ADY54545.1| methionyl-tRNA synthetase [Syntrophobotulus glycolicus DSM 8271]
          Length = 655

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/515 (43%), Positives = 324/515 (62%), Gaps = 20/515 (3%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I YPNA PHIG AY  I AD +AR  R+ G DV F TGTDE+ QKI + A++ 
Sbjct: 2   KYYITTPIYYPNASPHIGTAYTTIAADAMARLRRMMGDDVYFLTGTDENAQKIVRTAESK 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G+    +VD     F+++  +LDIS DDFIRTTE+RH    +  + K+ ++GDIYK  Y 
Sbjct: 62  GMAPLDYVDNIVAKFKELWRILDISNDDFIRTTEERHAKVVQHFFTKLFEQGDIYKSEYE 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY    E ++ ++ + +G        +   V+ ++EE YFFRLS YQD+LL Y +++PE
Sbjct: 122 GWYCTPCETFWTENRLVEGRCPNLDCGRE--VELLKEESYFFRLSKYQDRLLEYIKANPE 179

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           FI P+ RRNE+I F++SGL+DL ++R TF+WGI++P DP++++YVW+DAL NY++  GY 
Sbjct: 180 FIQPVSRRNEMIKFIESGLEDLCVTRTTFEWGIQVPFDPKHVVYVWLDALINYISALGY- 238

Query: 246 DNPDGSK-AKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK-GEKI 303
             PDG K  ++WPADLH++GKDI+RFH + WP  L++  +PLPKKVF HG+ + K G KI
Sbjct: 239 --PDGEKYQRYWPADLHLVGKDIVRFHTVIWPIILMAMEIPLPKKVFGHGWFMSKEGGKI 296

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKS GNV D  E+I   G D +RYFL++E+  G DG Y +D L +++N+DLAN +GN +S
Sbjct: 297 SKSRGNVQDSFELIARYGSDPIRYFLLKEMQYGLDGTYSEDDLVEKLNSDLANDLGNFIS 356

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           RS++M+ K  DG++P PG  +  D+ +  +   V   I E M +    +A+  +   VS 
Sbjct: 357 RSLAMVEKYRDGIVPEPGEDSVLDKELKELAVSVKTGIEEKMLDCDTAKAIEYLWQFVSR 416

Query: 424 VDRYFDAQKPWELKKTNPD---RASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
            ++Y D   PW L + +P+   R  TVLY  +E IR L +    F+P +  K+  +L   
Sbjct: 417 CNKYVDETAPWALAR-DPEQKCRLDTVLYNLIEAIRILGVFCAPFMPGIPLKLQPLL--- 472

Query: 481 DENRCFQSLDQRLK-----PGFMLHKTFDPIFPRF 510
           +    F   +   K     PG  + K  DPIFPR 
Sbjct: 473 NSGNLFTKWNDAGKWKIIVPGTKVIKG-DPIFPRI 506


>gi|302332203|gb|ADL22396.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 657

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKPIFPRL 522


>gi|253680951|ref|ZP_04861754.1| methionine--tRNA ligase [Clostridium botulinum D str. 1873]
 gi|253562800|gb|EES92246.1| methionine--tRNA ligase [Clostridium botulinum D str. 1873]
          Length = 646

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 311/470 (66%), Gaps = 7/470 (1%)

Query: 7   LYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAG 66
            YI+T I YP+A+ HIG+ Y  + AD +ARF RL G D  F TGTDEHGQKI + A+  G
Sbjct: 6   FYITTPIYYPSAKLHIGNTYTTVAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEAKG 65

Query: 67  VTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSG 126
           +T K +VD+     +D+  V+++ YD FIRTT+  H +T + ++KK+ DKGDIYKG Y G
Sbjct: 66  ITPKEYVDEIVSGIKDLWKVMNVKYDKFIRTTDDYHVETVQKIFKKLYDKGDIYKGEYEG 125

Query: 127 WYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEF 186
            Y    E+++ + ++  G       A    V+  +EE YFF++S Y D+L+ Y E+H EF
Sbjct: 126 LYCTPCESFWTETQLVDGKCPDCGRA----VEKTKEEAYFFKMSKYADRLIEYIETHSEF 181

Query: 187 ILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           I P  R+NE+++ F++ GL+DL +SR +F+WGI +  D ++++YVWIDALTNY+T  GY 
Sbjct: 182 IQPESRKNEMLNNFLRPGLQDLCISRTSFNWGIPVSFDEKHVIYVWIDALTNYITALGYN 241

Query: 246 DNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISK 305
            + D    K+WPA++H++GKDILRFH IYWP  L++ +LPLPK+VF HG++L  G K+SK
Sbjct: 242 QDNDELYQKYWPANVHLVGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSK 301

Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRS 365
           S GNV+DP+ ++   G DA+RY+L+ EI  G+DG Y  +   K+ N+DLAN +GNLV+R+
Sbjct: 302 SKGNVVDPVTLVNHFGTDAVRYYLLHEIPFGQDGMYTSETFIKKTNSDLANDLGNLVNRT 361

Query: 366 VSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVD 425
           ++MI K +DG+IP P A  + D+ ++ V   + + +   M    I  AL ++ +LV   +
Sbjct: 362 IAMINKYFDGVIPAPTAKDDIDDELIKVALEIPERVERKMDLLKIPEALDEIWTLVRRSN 421

Query: 426 RYFDAQKPWELKKT--NPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           +Y D   PW L K     +R  TVLY  VE +R ++++L AF+P+ + KI
Sbjct: 422 KYIDETMPWALAKEEDKKERLGTVLYNLVESLRIVSVILSAFLPETSKKI 471


>gi|21282174|ref|NP_645262.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2]
 gi|49485354|ref|YP_042575.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297207407|ref|ZP_06923846.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300910366|ref|ZP_07127819.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus TCH70]
 gi|25009356|sp|Q8NY00|SYM_STAAW RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|60390700|sp|Q6GBZ8|SYM_STAAS RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|21203610|dbj|BAB94310.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2]
 gi|49243797|emb|CAG42222.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887970|gb|EFH26864.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300888355|gb|EFK83542.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus TCH70]
          Length = 657

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/523 (41%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SM+ K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKPIFPRL 522


>gi|157363213|ref|YP_001469980.1| methionyl-tRNA synthetase [Thermotoga lettingae TMO]
 gi|157313817|gb|ABV32916.1| methionyl-tRNA synthetase [Thermotoga lettingae TMO]
          Length = 624

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/495 (44%), Positives = 321/495 (64%), Gaps = 10/495 (2%)

Query: 6   KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65
           K YI+T I Y N+ PH+G AY  IIAD++AR+ R+ G DV F TGTDEHGQKI +A+ + 
Sbjct: 2   KFYITTPIYYVNSDPHVGSAYTTIIADIIARYKRMMGYDVFFLTGTDEHGQKILQASSSL 61

Query: 66  GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125
           G   + F D+ +  F+ +   L+I+ D FIRTT+  H    +   KK+ +  DIYKG Y 
Sbjct: 62  GKDPQSFCDELADRFKQLWKKLNITNDGFIRTTDPNHMKVVQYFVKKMVENNDIYKGEYR 121

Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185
           GWY +  E Y+N+DE+  G+D +   +    ++++ E+ YFFRLS YQDKLL YYE HPE
Sbjct: 122 GWYCVPCETYWNEDEI--GSD-KLCPSCGRELKYVSEQNYFFRLSRYQDKLLRYYEEHPE 178

Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245
           F+ P  RRNE++  ++ GLKDLS++R TF WG+ +PDDP++++YVW+DAL NY++  GY 
Sbjct: 179 FVQPDFRRNEMMRILEGGLKDLSITRTTFKWGVPMPDDPEHVIYVWVDALINYISAIGY- 237

Query: 246 DNPDGSKA--KFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
             P+  K   K+WPADLH+IGK+I RFH+I WPA L+SA L LP+ VF+HG++   G+KI
Sbjct: 238 --PEDLKTFEKYWPADLHLIGKEINRFHSIIWPAMLMSAGLELPRTVFAHGWLTVDGQKI 295

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDP   +EE G D LR++LVR+I  GKDG + +  L  R+N+DLAN  GNL+ 
Sbjct: 296 SKSLGNAIDPKYFVEEYGNDVLRFYLVRDINFGKDGDFSEKNLVNRLNSDLANDYGNLLH 355

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+++MI K Y   +P PGA  + DE       +  +E ++ M    + +A+ +V+  ++ 
Sbjct: 356 RTLAMIKKYYSSTMPRPGAHEQIDEKFKHDILQCCKEYQQFMDQYSLTQAVEKVMEALAI 415

Query: 424 VDRYFDAQKPWEL-KKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL-FVAD 481
            ++YFD +KPW L K+ + D+ STVL+   E + ++A +    +P  + ++F  L F   
Sbjct: 416 SNKYFDERKPWVLAKQKDFDKLSTVLFNVCESLLKVATMFSPIMPDSSEEVFSRLGFDQK 475

Query: 482 ENRCFQSLDQRLKPG 496
            ++        LKPG
Sbjct: 476 SSKYMLETWNILKPG 490


>gi|223044412|ref|ZP_03614445.1| methionyl-tRNA synthetase [Staphylococcus capitis SK14]
 gi|222442201|gb|EEE48313.1| methionyl-tRNA synthetase [Staphylococcus capitis SK14]
          Length = 656

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/521 (42%), Positives = 332/521 (63%), Gaps = 15/521 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KDTFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + + D L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTELEYLDEMIAGIKSLWDKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE YY +    D VY+  +   G+  ++ H  V+ ++EE YFF ++ Y D+L
Sbjct: 123 YEGWYSVPDETYYTESQLVDPVYENGEIVGGKSPDSGHE-VELVKEESYFFNINKYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L +Y+ +P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWIDAL
Sbjct: 182 LEFYDENPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY+++ GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYISSLGYLSDDEELFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N DLA
Sbjct: 302 ILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K + G +P   G   E DE + ++    ++   ENM++     AL
Sbjct: 362 NDLGNLVNRTISMINKYFQGELPAYQGPKHELDEDMEAMALETVKNFNENMESLQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKKTNPDR--ASTVLYVTVEVIRQLAILLQAFVPKLANK 472
           + V   +S  ++Y D  +PW L K    R     V+   VE IR  A+LLQ F+     +
Sbjct: 422 STVWKFISRTNKYIDETQPWVLAKDEDQRDMLGNVMAHLVENIRFAAVLLQPFLTHAPRE 481

Query: 473 IFDILFVADENRC-FQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +F  L + D      +SL+    L    ++ +   PIFPR 
Sbjct: 482 VFKQLNMNDPKLSQLESLESYGALTEPILVTEKPTPIFPRL 522


>gi|315660343|ref|ZP_07913196.1| methionine--tRNA ligase [Staphylococcus lugdunensis M23590]
 gi|315494632|gb|EFU82974.1| methionine--tRNA ligase [Staphylococcus lugdunensis M23590]
          Length = 657

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/521 (42%), Positives = 334/521 (64%), Gaps = 15/521 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D      + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTELEYLDDMIAGIKSLWSKLEISNDDFIRTTEQRHKQVVEKVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE YY +    D +Y+      G+  ++ H  V+ ++EE YFF +S Y D+L
Sbjct: 123 YEGWYSVPDETYYTESQLVDPIYENGKIVGGKSPDSGHE-VELVKEESYFFNISKYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L +Y+ +P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWIDAL
Sbjct: 182 LEFYDQNPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY+++ GYL + D    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYISSLGYLSDDDALFQKYWPADVHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N DLA
Sbjct: 302 ILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K + G +P   G   E D+++ ++    +++  +NM++     AL
Sbjct: 362 NDLGNLVNRTISMINKYFQGELPAYTGPKHELDDAMEALALETVKDFNDNMESFQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANK 472
           A V  L+S  ++Y D   PW L K  +  D  + V+   +E IR   +LL+ F+     +
Sbjct: 422 ATVWKLISRTNKYIDETTPWVLAKDDSQKDMLANVMAHLIENIRFATVLLRPFLTHAPRE 481

Query: 473 IFDILFV-ADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +F  L + + E     SL++   LK   M+ +   PIFPR 
Sbjct: 482 VFKQLNINSPELFELASLERYGALKQAVMVTEKPSPIFPRL 522


>gi|15923480|ref|NP_371014.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926167|ref|NP_373700.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           N315]
 gi|156978818|ref|YP_001441077.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3]
 gi|253316233|ref|ZP_04839446.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253735224|ref|ZP_04869389.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005283|ref|ZP_05143884.2| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|258429606|ref|ZP_05688280.1| methionyl-tRNA synthetase [Staphylococcus aureus A9299]
 gi|269202110|ref|YP_003281379.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282895097|ref|ZP_06303317.1| methionyl-tRNA synthetase [Staphylococcus aureus A8117]
 gi|296276555|ref|ZP_06859062.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MR1]
 gi|54039687|sp|P67579|SYM_STAAN RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|54042047|sp|P67578|SYM_STAAM RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|13700380|dbj|BAB41678.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246258|dbj|BAB56652.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|156720953|dbj|BAF77370.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3]
 gi|253726784|gb|EES95513.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257849665|gb|EEV73632.1| methionyl-tRNA synthetase [Staphylococcus aureus A9299]
 gi|262074400|gb|ACY10373.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282762515|gb|EFC02655.1| methionyl-tRNA synthetase [Staphylococcus aureus A8117]
          Length = 657

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/523 (41%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SM+ K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKPIFPRL 522


>gi|314937303|ref|ZP_07844645.1| methionine--tRNA ligase [Staphylococcus hominis subsp. hominis C80]
 gi|313654599|gb|EFS18349.1| methionine--tRNA ligase [Staphylococcus hominis subsp. hominis C80]
          Length = 659

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 222/524 (42%), Positives = 334/524 (63%), Gaps = 15/524 (2%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M  +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI +
Sbjct: 1   MMAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQE 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            AQ AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY
Sbjct: 61  KAQKAGKTELEYLDEMIAGIKRLWAKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIY 120

Query: 121 KGCYSGWYSLRDEAYYND----DEVY---KGADGQYYNAQHNPVQWMEEEGYFFRLSAYQ 173
            G Y GWYS+ DE YY +    D VY   K A G+  ++ H  V+ ++EE YFF ++ Y 
Sbjct: 121 LGEYEGWYSVPDETYYTESQLVDPVYENGKIAGGKSPDSGHE-VELVKEESYFFNINKYT 179

Query: 174 DKLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWI 232
           D+LL +Y+++P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWI
Sbjct: 180 DRLLEFYDANPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWI 239

Query: 233 DALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFS 292
           DAL NY+++ GYL + D    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+
Sbjct: 240 DALVNYISSLGYLSDDDSLFQKYWPADVHLMAKEIVRFHSIIWPILLMALDLPLPKKVFA 299

Query: 293 HGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNA 352
           HG+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N 
Sbjct: 300 HGWILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNF 359

Query: 353 DLANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIH 411
           DLAN +GNLV+R++SMI K + G +P   G   E DE + ++    ++   +NM++    
Sbjct: 360 DLANDLGNLVNRTISMINKYFQGELPAYQGPKHELDEDMEALALETVKNFHDNMESFQFS 419

Query: 412 RALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKL 469
            AL+ V  L+S  ++Y D   PW L K  +  D    V+   VE IR   +LL+ F+   
Sbjct: 420 VALSTVWKLISRTNKYIDETTPWVLAKDESQKDMLGNVMAHLVENIRFATVLLRPFLTHA 479

Query: 470 ANKIFDILFVADENRC-FQSLDQ--RLKPGFMLHKTFDPIFPRF 510
             +IF  L + + +     SL+    L+   M+ +   PIFPR 
Sbjct: 480 PKEIFKQLNINNSDLYELSSLEHYGALQEPIMVTEKPSPIFPRL 523


>gi|57651372|ref|YP_185421.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL]
 gi|88194248|ref|YP_499040.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|151220665|ref|YP_001331487.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|221142318|ref|ZP_03566811.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|258452829|ref|ZP_05700824.1| methionyl-tRNA synthetase [Staphylococcus aureus A5948]
 gi|262049975|ref|ZP_06022834.1| methionyl-tRNA synthetase [Staphylococcus aureus D30]
 gi|282925564|ref|ZP_06333217.1| methionyl-tRNA synthetase [Staphylococcus aureus A9765]
 gi|284023499|ref|ZP_06377897.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus 132]
 gi|304380506|ref|ZP_07363183.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|81695187|sp|Q5HII6|SYM_STAAC RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|57285558|gb|AAW37652.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL]
 gi|87201806|gb|ABD29616.1| methionyl-tRNA synthetase, putative [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150373465|dbj|BAF66725.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|257859515|gb|EEV82368.1| methionyl-tRNA synthetase [Staphylococcus aureus A5948]
 gi|259161910|gb|EEW46493.1| methionyl-tRNA synthetase [Staphylococcus aureus D30]
 gi|269940061|emb|CBI48437.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282592468|gb|EFB97480.1| methionyl-tRNA synthetase [Staphylococcus aureus A9765]
 gi|302750380|gb|ADL64557.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340951|gb|EFM06874.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|320139424|gb|EFW31302.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|329313208|gb|AEB87621.1| Methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329729770|gb|EGG66167.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus 21189]
          Length = 657

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/523 (41%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SM+ K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLNESIMVTGQPKPIFPRL 522


>gi|257427267|ref|ZP_05603668.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257275918|gb|EEV07386.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           65-1322]
          Length = 657

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGK 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRL 522


>gi|239616428|ref|YP_002939750.1| methionyl-tRNA synthetase [Kosmotoga olearia TBF 19.5.1]
 gi|239505259|gb|ACR78746.1| methionyl-tRNA synthetase [Kosmotoga olearia TBF 19.5.1]
          Length = 639

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/509 (40%), Positives = 332/509 (65%), Gaps = 7/509 (1%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           + K Y++T I Y N++PHIG AY  I+AD++AR+ RL G DV F TGTDEHGQK+ +AA+
Sbjct: 2   KPKFYVTTPIYYINSEPHIGSAYTTIVADIVARYKRLSGYDVFFLTGTDEHGQKVLQAAK 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
              +  + + DQ +  F+ +   L I+ D F+RTT++RH  T ++  KK+ + GD+YKG 
Sbjct: 62  EENLDPQTYSDQLAEKFKVLWKELQITNDYFVRTTDERHMKTVQLFVKKMLENGDVYKGK 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESH 183
           Y GWY +  E ++ ++++ K    +   +    V+W+ EE YFFRLS Y D LL +++ H
Sbjct: 122 YEGWYCVPCETFWTEEDIGKE---RVCPSCGREVKWVSEENYFFRLSKYNDALLKHFQEH 178

Query: 184 PEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTG 243
           PEF+ P  RRNE++  +++GL+DLS++R +F WG+ +P+DP++++YVW+DAL NY++  G
Sbjct: 179 PEFVQPDFRRNEMLRILENGLRDLSITRTSFKWGVPMPNDPEHVIYVWVDALINYISAIG 238

Query: 244 YLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKI 303
           Y+D+P+ +  ++WPAD+H+IGK+I RFH++ WPA L+S  LPLPK++++HG++   G+KI
Sbjct: 239 YIDDPE-TFHRYWPADVHIIGKEINRFHSLIWPAMLMSVGLPLPKQIYAHGWLTVNGQKI 297

Query: 304 SKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVS 363
           SKSLGN IDP E ++  G DA+RY+L+R+I  G+DG + ++ L  R+NADLAN +GNL+ 
Sbjct: 298 SKSLGNAIDPREFVKAYGNDAVRYYLLRDIQFGRDGDFSEENLVHRINADLANDLGNLLH 357

Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423
           R+V+MI K  +G++P  G   + D  +  +   V+ E  ++M N     +L  +      
Sbjct: 358 RTVAMIEKFNNGIVPKKGVVEDVDNQLYGLAEEVIAEYIDHMDNLRFTPSLDAIWRFARF 417

Query: 424 VDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVAD 481
            ++Y D  +PW+L K     +R +TVLY  V+ +R ++++++  +P  A  I + +  A 
Sbjct: 418 GNKYIDLTEPWKLGKDPEKAERLNTVLYNLVDTLRIVSLMIEPVMPNTAKAIRERIGQAV 477

Query: 482 ENRCFQSLDQRLKPGFMLHKTFDPIFPRF 510
           E   F  L   L    +  K  +P+FPR 
Sbjct: 478 E-LDFTHLKLGLTKNGVGVKHGEPLFPRI 505


>gi|49482717|ref|YP_039941.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257424601|ref|ZP_05601029.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257429904|ref|ZP_05606290.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432607|ref|ZP_05608969.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435511|ref|ZP_05611561.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282903075|ref|ZP_06310967.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus C160]
 gi|282904865|ref|ZP_06312725.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282907812|ref|ZP_06315650.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910128|ref|ZP_06317934.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282913317|ref|ZP_06321108.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus M899]
 gi|282918271|ref|ZP_06326011.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282923022|ref|ZP_06330708.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283957279|ref|ZP_06374737.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293500366|ref|ZP_06666218.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509304|ref|ZP_06668020.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293515893|ref|ZP_06670583.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus M1015]
 gi|295427024|ref|ZP_06819661.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591600|ref|ZP_06950237.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus MN8]
 gi|60390704|sp|Q6GJI1|SYM_STAAR RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|49240846|emb|CAG39513.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257272628|gb|EEV04748.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257279420|gb|EEV10015.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282472|gb|EEV12605.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285148|gb|EEV15265.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282314541|gb|EFB44928.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317837|gb|EFB48206.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322788|gb|EFB53108.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus M899]
 gi|282325976|gb|EFB56282.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328288|gb|EFB58563.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331982|gb|EFB61491.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282596501|gb|EFC01461.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus C160]
 gi|283791203|gb|EFC30013.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290921301|gb|EFD98359.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus M1015]
 gi|291096326|gb|EFE26586.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467849|gb|EFF10359.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295129027|gb|EFG58656.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575469|gb|EFH94186.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus MN8]
 gi|312436421|gb|ADQ75492.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus TCH60]
 gi|315193851|gb|EFU24245.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 657

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRL 522


>gi|289551711|ref|YP_003472615.1| Methionyl-tRNA synthetase [Staphylococcus lugdunensis HKU09-01]
 gi|289181242|gb|ADC88487.1| Methionyl-tRNA synthetase [Staphylococcus lugdunensis HKU09-01]
          Length = 657

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 220/521 (42%), Positives = 334/521 (64%), Gaps = 15/521 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D      + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTELEYLDDMIAGIKSLWSKLEISNDDFIRTTEQRHKQVVEKVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE YY +    D +Y+      G+  ++ H  V+ ++EE YFF +S Y D+L
Sbjct: 123 YEGWYSVPDETYYTESQLVDPIYENGKIVGGKSPDSGHE-VELVKEESYFFNISKYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L +Y+ +P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWIDAL
Sbjct: 182 LEFYDQNPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY+++ GYL + D    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYISSLGYLSDDDALFQKYWPADVHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N DLA
Sbjct: 302 ILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K + G +P   G   E D+++ ++    +++  +NM++     AL
Sbjct: 362 NDLGNLVNRTISMINKYFQGELPAYTGPKHELDDAMEALALETVKDFNDNMESFQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANK 472
           A V  L+S  ++Y D   PW L K  +  D  + V+   VE IR   +LL+ F+     +
Sbjct: 422 ATVWKLISRTNKYIDETTPWVLAKDDSQKDMLANVMAHLVENIRFATVLLRPFLTHAPRE 481

Query: 473 IFDILFV-ADENRCFQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +F  L + + E     SL++   LK   M+ +   PIFPR 
Sbjct: 482 VFKQLNINSPELFELASLERYGALKQPVMVTEKPSPIFPRL 522


>gi|329731069|gb|EGG67441.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus 21193]
          Length = 657

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/523 (41%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SM+ K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKPIFPRL 522


>gi|312897476|ref|ZP_07756900.1| methionyl-tRNA synthetase [Megasphaera micronuciformis F0359]
 gi|310621537|gb|EFQ05073.1| methionyl-tRNA synthetase [Megasphaera micronuciformis F0359]
          Length = 648

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 216/479 (45%), Positives = 310/479 (64%), Gaps = 7/479 (1%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
           KE++  YI+T I YP+A+ HIGH Y   IAD LARFHRL G D LF TG+DEHGQKI +A
Sbjct: 4   KEKKTYYITTPIYYPSAKLHIGHTYCTTIADSLARFHRLRGDDTLFITGSDEHGQKIQRA 63

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYK 121
           A+  G+    +VD     F+D+   L+IS D FIRTTE RH    + L ++  D GDIYK
Sbjct: 64  AEAQGMKPIEYVDGIVALFKDLWKRLNISNDVFIRTTEPRHERVVQDLMQRSFDNGDIYK 123

Query: 122 GCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHN-PVQWMEEEGYFFRLSAYQDKLLSYY 180
             Y GWY   DE ++ ++++    DG++       P++ ++EE YF RL+ Y D+ L + 
Sbjct: 124 SEYEGWYCTPDETFWPENKL---PDGKHVCPDCGRPLELVKEESYFLRLNKYADRWLKFI 180

Query: 181 ESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLT 240
           E +P+FI P  RRNE+I+FVKSGL+DLS+SR +FDWGIK+P DP++++YVW DAL NYLT
Sbjct: 181 EENPDFIQPESRRNEMIAFVKSGLEDLSISRTSFDWGIKVPWDPKHVVYVWFDALANYLT 240

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GYL++P+    KFWPA LH++GK+I+RFH I WP  L+S  LPLPKKVF HG+++  G
Sbjct: 241 AAGYLEDPENFD-KFWPASLHLVGKEIVRFHTIIWPIMLMSCGLPLPKKVFGHGWLIVDG 299

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKSLGNV+DP+ +IE  G DALRY+L++E+  G+DG +       R+NADLAN +GN
Sbjct: 300 TKMSKSLGNVVDPVPLIERYGADALRYYLLKEVRLGQDGNFSLPTFINRINADLANDLGN 359

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+ R+++M+ K  DG++  P      D+ + ++    +++    M +  I  AL  +  L
Sbjct: 360 LLQRTLAMVEKYEDGVVAGPTDKEAVDDELAALAVETVRKFEAEMDDMKIDDALNDIWGL 419

Query: 421 VSEVDRYFDAQKPWELKKTNP--DRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477
           +   ++Y D   PW L K      R  TVLY  +E +R +++L+   +P  A  ++  L
Sbjct: 420 IRRSNKYIDETVPWVLAKDADCVGRLRTVLYNLMESLRIISVLVSPVIPASAENMWTQL 478


>gi|188997460|ref|YP_001931711.1| methionyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932527|gb|ACD67157.1| methionyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 628

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/513 (43%), Positives = 322/513 (62%), Gaps = 21/513 (4%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +EK Y++T I Y N  PH+GHAY  + ADVLAR++R  G+   F TGTDEHGQKI K A+
Sbjct: 2   QEKFYVTTPIYYVNDVPHLGHAYTTVAADVLARYYRQIGVKTFFLTGTDEHGQKIQKTAE 61

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
             G++ K   D+    F+++   L+ISYD FIRTT+  H    + +++K  + GDIY   
Sbjct: 62  EKGISPKELADKTHLAFKELWKKLNISYDRFIRTTDPDHIKAVQHIFQKCYENGDIYLSE 121

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSYYES 182
           Y  +Y +  E +  + E+    D  Y    H  P + ++EE YFFRLS Y DKLL +YE 
Sbjct: 122 YESYYCVGCEEFKTETEI---KDYDYKCPIHLKPCEKVKEESYFFRLSKYTDKLLEFYEK 178

Query: 183 HPEFILPIERRNEVISFVKSGLKDLSLSRKT--FDWGIKIPDDPQYIMYVWIDALTNYLT 240
           +PEFILP  R+NEV+SFVK GLKDLS+SRK     WGI +P DP + +YVW DALTNYLT
Sbjct: 179 NPEFILPDFRKNEVVSFVKQGLKDLSVSRKRDRVAWGIPVPFDPSHTIYVWFDALTNYLT 238

Query: 241 TTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKG 300
             GY +N +    +FWPAD+H++GKDILRFHA+YWPAFL+SA L + KKVF+HG+   +G
Sbjct: 239 AVGYPENLN----EFWPADVHIVGKDILRFHAVYWPAFLMSARLEISKKVFAHGWWTVEG 294

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360
            K+SKSLGNV+DP +  +E GVD LRYFL+RE+  G DG + K  +  R+N+DLAN +GN
Sbjct: 295 HKMSKSLGNVVDPFKAADEFGVDKLRYFLLREVPFGLDGDFSKSAVINRINSDLANDLGN 354

Query: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420
           L+SRS++MI K  +G I  P  F E +E   +V S+ L+  +  +Q     ++L +V   
Sbjct: 355 LISRSLTMIHKFQNGKIEKPSVFKEIEEEYKNVYSKTLENYKNFIQKLEFSKSLEEVWQF 414

Query: 421 VSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVA 480
           +  +++Y    +PW+L K + +   T LY  V+ I  +  +L  F+P+   +   +L + 
Sbjct: 415 IDWLNKYIVKVEPWKLNKEDKEYLKTTLYTVVDGIYAVVWMLNPFMPQKMAEALSMLNIN 474

Query: 481 DENRCFQSLDQRLKP-GFMLHKTFD---PIFPR 509
           +       + + +KP  F +  T +   P+FPR
Sbjct: 475 E-------IKKDIKPYSFPVEITINQVVPLFPR 500


>gi|170755122|ref|YP_001779702.1| methionyl-tRNA synthetase [Clostridium botulinum B1 str. Okra]
 gi|169120334|gb|ACA44170.1| methionyl-tRNA synthetase [Clostridium botulinum B1 str. Okra]
          Length = 645

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 311/469 (66%), Gaps = 7/469 (1%)

Query: 8   YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67
           Y++T I YP+A+ HIG+ Y  + AD LARF RL G DV+F TGTDEHGQKI + A+   V
Sbjct: 7   YVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKV 66

Query: 68  TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYSGW 127
           T K +VD+     +++  +++I YD FIRTT++ H +  + ++K + DKGDIYK  YSGW
Sbjct: 67  TPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGW 126

Query: 128 YSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPEFI 187
           Y    E+++ + ++    DG+  +    PV+  +EE YFF++S Y  KL+ Y ESHPEFI
Sbjct: 127 YCTPCESFWTETQL---EDGKCPDCGR-PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFI 182

Query: 188 LPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYLD 246
            P  R+NE+++ F+K GL+DL +SR +FDWGI +  D ++++YVWIDAL NY+T  GY  
Sbjct: 183 QPESRKNEMLNNFLKPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNT 242

Query: 247 NPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKS 306
             D    K+WPAD+H++GKDILRFH IYWP  L++ ++PLPK+VF HG++L  G K+SKS
Sbjct: 243 EKDELYKKYWPADVHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKS 302

Query: 307 LGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSV 366
            GNV+DP+ ++   G D +RY+L+REI  G DG ++ +   K++N+DLAN +GNL+SR+V
Sbjct: 303 KGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTV 362

Query: 367 SMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDR 426
           +MI K +DG IP      + DE ++ +     +++ ENM    I  AL ++ + +   ++
Sbjct: 363 AMIEKYFDGEIPAGNCKEDIDEELIKLALETPKKVEENMGKLRIPEALEEIWTFIGRANK 422

Query: 427 YFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKI 473
           Y D   PW L K  +  +R  TVLY   E +R +++ + AF+P+ + KI
Sbjct: 423 YIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCILAFIPETSIKI 471


>gi|283469782|emb|CAQ48993.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 657

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHQVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRL 522


>gi|15896243|ref|NP_349592.1| methionyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824]
 gi|25009386|sp|Q97EW5|SYM_CLOAB RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|15026047|gb|AAK80932.1|AE007796_2 Methionyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824]
 gi|325510398|gb|ADZ22034.1| methionyl-tRNA synthetase [Clostridium acetobutylicum EA 2018]
          Length = 644

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 309/476 (64%), Gaps = 7/476 (1%)

Query: 1   MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60
           M E++K YI+T I YP+A+ HIG+ Y  + +D L RF RL G D    TGTDEHGQKI +
Sbjct: 1   MSEKKKFYITTPIYYPSAKLHIGNTYTTVASDALVRFKRLQGYDAFMLTGTDEHGQKIQR 60

Query: 61  AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120
            A++ G+T K +VD+     +D+  +++ISYD FIRTT++ H    + + KK  D GDIY
Sbjct: 61  IAEDKGITPKAYVDEIVAGIKDLWKMMNISYDKFIRTTDEEHVKAVQKIVKKFYDNGDIY 120

Query: 121 KGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYY 180
           K  Y GWY    E+++ + ++    DG+  +    PV+  +EE YFF++S Y D+L+ Y 
Sbjct: 121 KSAYEGWYCTPCESFWTETQL---VDGKCPDCGR-PVEKTKEEAYFFKMSKYADRLIKYI 176

Query: 181 ESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239
           E HP+FI P  R+NE+++ F+K GL+DL +SR +FDWGI I  D ++++YVWIDAL+NY+
Sbjct: 177 EDHPDFIQPESRKNEMLNNFLKPGLQDLCISRSSFDWGIPITFDEKHVIYVWIDALSNYI 236

Query: 240 TTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK 299
           T  GY  + D    KFWPADLH++GKDI+RFH IYWP  L++ +LPLPK+VF HG++L  
Sbjct: 237 TALGYGSDNDELYNKFWPADLHLVGKDIIRFHTIYWPIMLMALDLPLPKQVFGHGWLLVD 296

Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359
           G K+SKS GNV+DP+ +I E G D +RY+L+ EI  G DG ++ +   K++N+DLAN +G
Sbjct: 297 GGKMSKSKGNVVDPVVLINEFGTDPVRYYLLHEIPFGSDGLFNNEIFIKKINSDLANDLG 356

Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVIS 419
           NLVSR+ +MI K +DG I  P    E D  ++ +   + +++ E+++   I  AL  +  
Sbjct: 357 NLVSRTAAMIEKYFDGSIQPPVDKEEIDNELIDMAISLPEKLDEDIKKLKIPEALDHIWD 416

Query: 420 LVSEVDRYFDAQKPWELKKTNPDRA--STVLYVTVEVIRQLAILLQAFVPKLANKI 473
           L+   ++Y D   PW L K    +A   TVLY  VE +R +A  L  F+P+   KI
Sbjct: 417 LIKRANKYIDETTPWVLAKDENKKARLGTVLYNLVESLRFVATTLTPFLPETGEKI 472


>gi|242371680|ref|ZP_04817254.1| methionyl-tRNA synthetase [Staphylococcus epidermidis M23864:W1]
 gi|242350629|gb|EES42230.1| methionyl-tRNA synthetase [Staphylococcus epidermidis M23864:W1]
          Length = 656

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/521 (42%), Positives = 331/521 (63%), Gaps = 15/521 (2%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           ++  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KDTFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + + D L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTELEYLDEMIAGIKSLWDKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE YY +    D VY+      G+  ++ H  V+ ++EE YFF ++ Y D+L
Sbjct: 123 YEGWYSVPDETYYTESQLVDPVYENGKIVGGKSPDSGHE-VELVKEESYFFNINKYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L +Y+ +P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWIDAL
Sbjct: 182 LEFYDENPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY+++ GYL   +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYISSLGYLSEDETLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N DLA
Sbjct: 302 ILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K + G +P   G   E DE + ++    ++   ENM++     AL
Sbjct: 362 NDLGNLVNRTISMINKYFHGELPAYQGPKHELDEDMEAMALETVKNFNENMESLQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANK 472
           + V   +S  ++Y D  +PW L K  +  D    V+   VE IR  A+LLQ F+     +
Sbjct: 422 STVWKFISRTNKYIDETQPWVLAKDESQRDMLGNVMAHLVENIRFSAVLLQPFLTHAPRE 481

Query: 473 IFDILFVADENRC-FQSLDQ--RLKPGFMLHKTFDPIFPRF 510
           +F  L + +      +SL+    L    M+ +   PIFPR 
Sbjct: 482 MFKQLNINNPKLTELESLESYGALTEPIMVTEKPSPIFPRL 522


>gi|70727520|ref|YP_254436.1| methionyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435]
 gi|82582279|sp|Q4L3E7|SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase; AltName:
           Full=Methionine--tRNA ligase; Short=MetRS
 gi|68448246|dbj|BAE05830.1| methionyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435]
          Length = 659

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 221/522 (42%), Positives = 333/522 (63%), Gaps = 17/522 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV++R+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVISRYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE RH      +++++  +GDIY G 
Sbjct: 63  KAGKTELEYLDEMISGIKSLWSKLEISNDDFIRTTEDRHKQVVEKVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYND----DEVYKGAD---GQYYNAQHNPVQWMEEEGYFFRLSAYQDKL 176
           Y GWYS+ DE YY +    D +Y+      G+  ++ H  V+ ++EE YFF ++ Y D+L
Sbjct: 123 YEGWYSVPDETYYTESQLVDPIYENGKIVGGKSPDSGHE-VELVKEESYFFNINKYTDRL 181

Query: 177 LSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDAL 235
           L +Y+++P+FI P  R+NE+I+ F+K GL+DL++SR +FDWG+++P +P++++YVWIDAL
Sbjct: 182 LEFYDANPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDAL 241

Query: 236 TNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGF 295
            NY++  GYL + D    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+HG+
Sbjct: 242 VNYISALGYLSDDDELFQKYWPADVHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGW 301

Query: 296 ILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLA 355
           IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N DLA
Sbjct: 302 ILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLA 361

Query: 356 NGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHRAL 414
           N +GNLV+R++SMI K + G +P   G   E DE + ++    ++   E+M++     AL
Sbjct: 362 NDLGNLVNRTISMINKYFQGELPAYEGPKHELDEDMEALAHETVKHFNESMESFQFSVAL 421

Query: 415 AQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLANK 472
           + V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+     +
Sbjct: 422 STVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRFAAVLLRPFLTHAPKE 481

Query: 473 IFDILFVADENRCF--QSLDQ--RLKPGFMLHKTFDPIFPRF 510
           IF  L + +E   F  +SL+Q   LK   M+ +   PIFPR 
Sbjct: 482 IFKQLNI-NEPELFELESLEQYGALKQPIMVTEKPTPIFPRL 522


>gi|282915808|ref|ZP_06323576.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283768925|ref|ZP_06341834.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus H19]
 gi|282320299|gb|EFB50641.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283461106|gb|EFC08192.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus H19]
          Length = 657

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 220/523 (42%), Positives = 328/523 (62%), Gaps = 19/523 (3%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63
           +E  YI+T I YP+   HIGHAY  +  DV+AR+ R+ G DV + TGTDEHGQKI + AQ
Sbjct: 3   KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQ 62

Query: 64  NAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123
            AG T   ++D+     + +   L+IS DDFIRTTE+RH      +++++  +GDIY G 
Sbjct: 63  KAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGE 122

Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQ---------HNPVQWMEEEGYFFRLSAYQD 174
           Y GWYS+ DE YY + ++    D QY N +          + V+ ++EE YFF +S Y D
Sbjct: 123 YEGWYSVPDETYYTESQL---VDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTD 179

Query: 175 KLLSYYESHPEFILPIERRNEVIS-FVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWID 233
           +LL +Y+ +P+FI P  R+NE+I+ F+K GL DL++SR +F+WG+ +P +P++++YVWID
Sbjct: 180 RLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWID 239

Query: 234 ALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSH 293
           AL NY++  GYL + +    K+WPAD+H++ K+I+RFH+I WP  L++ +LPLPKKVF+H
Sbjct: 240 ALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAH 299

Query: 294 GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNAD 353
           G+IL K  K+SKS GNV+DP  +I+  G+DA RY+L+RE+  G DG +  +   +R N D
Sbjct: 300 GWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFD 359

Query: 354 LANGIGNLVSRSVSMILKDYDGMIPT-PGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412
           LAN +GNLV+R++SMI K +DG +P   G   E DE + ++    ++   E+M++     
Sbjct: 360 LANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSV 419

Query: 413 ALAQVISLVSEVDRYFDAQKPWELKK--TNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470
           AL+ V   +S  ++Y D   PW L K  +  D    V+   VE IR  A+LL+ F+    
Sbjct: 420 ALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAP 479

Query: 471 NKIFDILFVADENRC-FQSLDQR--LKPGFMLHKTFDPIFPRF 510
            +IF+ L + +     F SL+Q   L    M+     PIFPR 
Sbjct: 480 KEIFEQLNINNPQFMEFSSLEQYGVLTVPIMVTGQPKPIFPRL 522


>gi|148266948|ref|YP_001245891.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9]
 gi|150392994|ref|YP_001315669.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1]
 gi|257794269|ref|ZP_05643248.1| methionyl-tRNA synthetase [Staphylococcus aureus A9781]
 gi|258407213|ref|ZP_05680358.1| methionyl-tRNA synthetase [Staphylococcus aureus A9763]
 gi|258420820|ref|ZP_05683756.1| methionyl-tRNA synthetase [Staphylococcus aureus A9719]
 gi|258446123|ref|ZP_05694284.1| methionyl-tRNA synthetase [Staphylococcus aureus A6300]
 gi|258453822|ref|ZP_05701795.1| methionyl-tRNA synthetase [Staphylococcus aureus A5937]
 gi|295407379|ref|ZP_06817176.1| m