RPSBLAST alignment for GI: 255764461 and conserved domain: TIGR00396

>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family. The leucyl-tRNA synthetases belong to two families so broadly different that they are represented by separate models. This model includes both eubacterial and mitochondrial leucyl-tRNA synthetases. It generates higher scores for some valyl-tRNA synthetases than for any archaeal or eukaryotic cytosolic leucyl-tRNA synthetase. Note that the enzyme from Aquifex aeolicus is split into alpha and beta chains; neither chain is long enough to score above the trusted cutoff, but the alpha chain scores well above the noise cutoff. The beta chain must be found by a model and search designed for partial length matches. Length = 842
 Score = 46.3 bits (110), Expect = 2e-05
 Identities = 41/149 (27%), Positives = 59/149 (39%), Gaps = 51/149 (34%)

Query: 228 MYVWIDALTNYLTTTGYLD--NP----DGSKAKFW-PADLHVIGKDILRFHAIY---WPA 277
           M  +  +   YL    YLD  N     D  KA++W P DL++ G +    H +Y   W  
Sbjct: 487 MDTFAGSSWYYL---RYLDPKNTDQPFDKEKAEYWLPVDLYIGGAEHAILHLLYARFWHK 543

Query: 278 FLLSANL-----PLPKKVFSHGFIL--------------------------------HKG 300
           FL          P  KK+ + G +L                                   
Sbjct: 544 FLYDIGYVSTKEPF-KKLINQGMVLGFYYPPNGKSPPDELTERDEKAKDKSGGELVVVGY 602

Query: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFL 329
           EK+SKS GN IDP E++++ G DALR ++
Sbjct: 603 EKMSKSKGNGIDPQEIVKKHGADALRLYI 631