RPSBLAST alignment for GI: 255764461 and conserved domain: PRK12268

>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed. Length = 556
 Score =  433 bits (1115), Expect = e-122
 Identities = 172/545 (31%), Positives = 275/545 (50%), Gaps = 46/545 (8%)

Query: 4   REKLYISTAIAYPNAQPHIGHAYE-MIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62
             ++ I++A  Y N   H+GH     + ADV AR+ RL G +VLF +G+DEHG  I  AA
Sbjct: 2   MMRILITSAWPYANGPLHLGHLAGSGLPADVFARYQRLKGNEVLFVSGSDEHGTPIELAA 61

Query: 63  QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122
           +  GVT +   D+     ++    L ISYD F RTT   HH+  +  + K+ + G IYK 
Sbjct: 62  KKEGVTPQELADKYHEEHKEDFKKLGISYDLFTRTTSPNHHEVVQEFFLKLYENGYIYKK 121

Query: 123 CYSGWYSLRDEAYYNDDEV-----YKGADGQYYN------AQHNPVQ------------- 158
                Y   D  +  D  V     Y G +G   +      A  +P               
Sbjct: 122 TIEQAYCPSDGRFLPDRYVEGTCPYCGYEGARGDQCDNCGALLDPTDLINPRSKISGSTP 181

Query: 159 -WMEEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWG 217
            + E E +F  L A+ ++L ++ ES      P    N  ++++K GLK  +++R   DWG
Sbjct: 182 EFRETEHFFLDLPAFAERLRAWIES--SGDWPPNVLNFTLNWLKEGLKPRAITR-DLDWG 238

Query: 218 IKIP--DDPQYIMYVWIDALTNYLTTTGYL----DNPDGSKAKFWP----ADLHVIGKDI 267
           I +P       + YVW DA+  Y++ +        +P+  K +FW        + IGKD 
Sbjct: 239 IPVPWPGFEGKVFYVWFDAVIGYISASKEWAERTGDPEAWK-EFWLDPETKSYYFIGKDN 297

Query: 268 LRFHAIYWPAFLLSAN--LPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDAL 325
           + FH+I WPA LL +   L LP ++ S  ++  +G K SKS G  I   + +E    D L
Sbjct: 298 IPFHSIIWPAMLLGSGEPLKLPDEIVSSEYLTLEGGKFSKSRGWGIWVDDALERYPPDYL 357

Query: 326 RYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTE 385
           RY+L        D  +  +   +RVN++LA+  GNLV+R +S I K + G I  PG   +
Sbjct: 358 RYYLAANAPENSDTDFTWEEFVRRVNSELADKYGNLVNRVLSFIEKYFGG-IVPPGELGD 416

Query: 386 SDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRAS 445
            D  +++    + +E+ E ++     +AL +++ L  E ++Y D + PW+L KT+ +RA+
Sbjct: 417 EDRELIAEAEALFKEVGELLEAGEFKKALEEIMELAREANKYLDEKAPWKLAKTDRERAA 476

Query: 446 TVLYVTVEVIRQLAILLQAFVPKLANKIFDIL-FVADENRCFQSLDQRLKPGFMLHKTFD 504
           TVLY  + ++R LA+LL  F+P  A KI+++L     E   ++SL   L PG  ++K  +
Sbjct: 477 TVLYTALNLVRLLAVLLYPFLPFSAQKIWEMLGGENIEKLTWESLK-PLLPGHPINK-PE 534

Query: 505 PIFPR 509
           P+F +
Sbjct: 535 PLFKK 539