RPSBLAST alignment for GI: 255764461 and conserved domain: PRK13804

>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional. Length = 961
 Score = 66.9 bits (164), Expect = 1e-11
 Identities = 39/115 (33%), Positives = 53/115 (46%), Gaps = 34/115 (29%)

Query: 227 IMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKD--------------ILRFHA 272
           I+ VW D+ + +      L++    K   WPADL++ G D                R  A
Sbjct: 559 ILDVWFDSGSTH---AFVLEDRPDLK---WPADLYLEGSDQHRGWFNSSLLESCGTRGRA 612

Query: 273 IYWPAFLLSANLPLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALR 326
            Y             K V +HGF L  KGEK+SKSLGN + P +VI++ G D LR
Sbjct: 613 PY-------------KAVLTHGFTLDEKGEKMSKSLGNTVSPQDVIKQSGADILR 654