RPSBLAST alignment for GI: 255764461 and conserved domain: PRK14900

>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional. Length = 1052
 Score = 39.2 bits (91), Expect = 0.003
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 11/58 (18%)

Query: 21  HIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSR 78
           H+GHA    + DVL R+ R+ G + L+  GTD           +AG+ T++ V++  +
Sbjct: 64  HLGHALTATLQDVLIRWKRMSGFNTLWLPGTD-----------HAGIATQMIVEKELK 110