RPSBLAST alignment for GI: 255764461 and conserved domain: COG0495

>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 814
 Score = 86.1 bits (213), Expect = 2e-17
 Identities = 45/183 (24%), Positives = 76/183 (41%), Gaps = 8/183 (4%)

Query: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61
            + EK Y+     YP+   H+GH     I DV+AR+ R+ G +VL   G D  G     A
Sbjct: 31  DKPEKFYVLVMFPYPSGALHVGHVRNYTIGDVIARYKRMQGYNVLHPMGWDAFGLPAENA 90

Query: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYD---DFIRTTEKRHHDTCRILWKKISDKGD 118
           A   G     +   N    +     L  S D   +F  T +  ++   +  + K+ +KG 
Sbjct: 91  AIKIGTDPAKWTYYNIAYMKKQLKSLGFSIDWRREFA-TCDPEYYKWIQWQFLKLYEKGL 149

Query: 119 IYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLS 178
            Y+      +   D     +++V  G   +       PV+  E   +FF+++ Y D+LL 
Sbjct: 150 AYRKEAPVNWCPVDGTVLANEQVIDGGCWR----CGEPVEIKELTQWFFKITDYADELLD 205

Query: 179 YYE 181
             +
Sbjct: 206 DLD 208