RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] (511 letters) >gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 558 Score = 567 bits (1464), Expect = e-162 Identities = 238/545 (43%), Positives = 338/545 (62%), Gaps = 36/545 (6%) Query: 1 MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAK 60 MK +K+ ++TA+ YPN PH+GH Y + ADV AR+ RL G +V F TGTDEHG KI Sbjct: 1 MKMMKKILVTTALPYPNGPPHLGHLYTYLAADVYARYLRLRGYEVFFLTGTDEHGTKIEL 60 Query: 61 AAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIY 120 A+ G+T + VD+N F+++ L+IS+D+FIRTT H + + + K+ + GDIY Sbjct: 61 KAEKEGITPQELVDKNHEEFKELFKALNISFDNFIRTTSPEHKELVQEFFLKLYENGDIY 120 Query: 121 KGCYSGWYSLRDEAYYNDDEV-----YKGADGQY----------YNAQH--NPVQWM--- 160 Y G Y + E + D V G + + NPV + Sbjct: 121 LREYEGLYCVSCERFLPDRYVEGTCPKCGGEDARGDQCENCGRTLDPTELINPVCVISGA 180 Query: 161 -----EEEGYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFD 215 EEE YFFRLS +QDKLL +YES+P+FI P RRNEV++F+K GLKDLS++R D Sbjct: 181 TPEVREEEHYFFRLSKFQDKLLEWYESNPDFIWPANRRNEVLNFLKEGLKDLSITRTDLD 240 Query: 216 WGIKIPDDPQYIMYVWIDALTNYLTTTGYL--DNPDGSKAKFWPAD----LHVIGKDILR 269 WGI +P DP ++YVW DAL Y++ G L D KFWPAD +H IGKDI+R Sbjct: 241 WGIPVPGDPGKVIYVWFDALIGYISALGELAEIGDDEDFKKFWPADDTELVHFIGKDIIR 300 Query: 270 FHAIYWPAFLLSANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFL 329 FHA+YWPA L++A LPLP ++F+HGF+ +G+K+SKS GNV+DP E++E+ GVDALRY+L Sbjct: 301 FHAVYWPAMLMAAGLPLPTRIFAHGFLTLEGQKMSKSRGNVVDPDELLEQYGVDALRYYL 360 Query: 330 VREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFT-ESDE 388 RE+ G DG + + +RVNADLAN +GNL +R++ I K +DG++P GA E DE Sbjct: 361 ARELPEGSDGDFSWEDFVERVNADLANKLGNLANRTLGFINKYFDGVVPAAGAPDLEEDE 420 Query: 389 SILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTN-PDRASTV 447 +L++ L+ + E M+ +AL ++++L S ++Y D Q PW+L K + +R +TV Sbjct: 421 ELLALAREALEAVAEAMEKYEFRKALEEIMALASRANKYIDEQAPWKLAKEDKRERLATV 480 Query: 448 LYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCF--QSLDQRLKPGFMLHKTFDP 505 LY+ +E++R LAILL F+P+ A KI+D L + ++ R F Q L PG L +P Sbjct: 481 LYLALELVRVLAILLYPFMPETAEKIWDQLGLEEDARNFTWLGARQPLLPGHKLGP-PEP 539 Query: 506 IFPRF 510 +FPR Sbjct: 540 LFPRI 544 >gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 578 Score = 458 bits (1180), Expect = e-129 Identities = 205/513 (39%), Positives = 297/513 (57%), Gaps = 16/513 (3%) Query: 3 EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62 E E ++T I Y NA PH+GH Y ++AD +ARF RL G V+F+TGTDEHG KI AA Sbjct: 37 EGETFVLTTPIFYVNAAPHLGHLYSTLLADAIARFQRLKGKKVIFSTGTDEHGLKIQTAA 96 Query: 63 QNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKG 122 G D+ S++FR + I+Y FIRTT+ +H + W ++ GDIY+G Sbjct: 97 ATNGRNPPELCDRISQSFRQLWKDAGIAYTKFIRTTDPKHEAIVQEFWARVFKNGDIYRG 156 Query: 123 CYSGWYSLRDEAYYNDDEVYK--GADGQYYNAQH-NPVQWMEEEGYFFRLSAYQDKLLSY 179 Y GWY + DE +Y + +V K G+ + + NPV W +E+ YFFRLS +Q L + Sbjct: 157 DYEGWYCVSDETFYPESKVLKNPCPPGKVVSMESGNPVVWRKEDNYFFRLSKFQKPLEDH 216 Query: 180 YESHPEFILPIERRNEVISFVKSGLKDLSLSRKT--FDWGIKIPDDPQYIMYVWIDALTN 237 +P F+ P N+V+S++K+GL DLS+SR + DWGI +P D +YVW DAL N Sbjct: 217 LRKNPRFVQPSYFHNQVLSWLKTGLPDLSISRPSARLDWGIPVPGDDSQTIYVWFDALLN 276 Query: 238 YLTTTGYLDNPDGSKAKF---WPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHG 294 Y++ GY + K WPA LHVIGKDILRFHA+YWPAFL++A LPLPK +F HG Sbjct: 277 YISVIGYPNKQQNLKTALSFGWPATLHVIGKDILRFHAVYWPAFLMAAGLPLPKMIFVHG 336 Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADL 354 G K+SKSLGNV+DP E++++ GVDA+RYFL+RE G DG Y ++ L K VNA L Sbjct: 337 HWTKNGMKMSKSLGNVVDPFELVQKYGVDAVRYFLLREGELGNDGDYSEEKLIKIVNAHL 396 Query: 355 ANGIGNLVSRSVSMIL----KDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLI 410 AN +GNL++R + L + ++ +P E E ++ ++ + N N + Sbjct: 397 ANTLGNLLNRCLGKKLNISNCESTLVVDSPTVAAE-GEPLVDTVEKLPEVAATNYDNFSL 455 Query: 411 HRALAQVISLVSEVDRYFDAQKPWELKKTNPDRA---STVLYVTVEVIRQLAILLQAFVP 467 + AL V+S+ + + + PW+L K + A + VL++ +EV+R + ILLQ P Sbjct: 456 YSALEAVLSIGNAGNTLVQQRAPWKLFKDSQVSAEELAKVLHIILEVLRVIGILLQPVAP 515 Query: 468 KLANKIFDILFVADENRCFQSLDQRLKPGFMLH 500 L+ ++ L V+ + R + P Sbjct: 516 SLSLRLLSQLGVSKDQRSLITWSPVFAPIEYGK 548 >gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function. Length = 319 Score = 442 bits (1140), Expect = e-124 Identities = 160/337 (47%), Positives = 217/337 (64%), Gaps = 23/337 (6%) Query: 6 KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65 K+ I+TA+ Y N PH+GH Y ++ADV AR+ RL G DVLF TGTDEHG KI + A+ Sbjct: 1 KVLITTALPYVNGVPHLGHLYGTVLADVFARYQRLRGYDVLFVTGTDEHGTKIEQKAEEE 60 Query: 66 GVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125 GVT + D+ F+D+ L+IS+D FIRTT RH + + +KK+ + G IY+G Y Sbjct: 61 GVTPQELCDKYHEIFKDLFKWLNISFDYFIRTTSPRHKEIVQEFFKKLYENGYIYEGEYE 120 Query: 126 GWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSYYESHPE 185 G Y + E + +W EEE YFFRLS +QD+LL + E +P+ Sbjct: 121 GLYCVSCERFLP--------------------EWREEEHYFFRLSKFQDRLLEWLEKNPD 160 Query: 186 FILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYLTTTGYL 245 FI P RNEV+S++K GLKDLS++R FDWGI +P DP ++YVW DAL Y++ TGY Sbjct: 161 FIWPENARNEVLSWLKEGLKDLSITRDLFDWGIPVPLDPGKVIYVWFDALIGYISATGYY 220 Query: 246 DNPDGS---KAKFWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHKGEK 302 + G+ WP +H IGKDI+RFHAIYWPA LL A LPLP ++ +HG++ +G+K Sbjct: 221 NEEWGNSWWWKDGWPELVHFIGKDIIRFHAIYWPAMLLGAGLPLPTRIVAHGYLTVEGKK 280 Query: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDG 339 +SKS GNV+DP +++E G DALRY+L+RE GKD Sbjct: 281 MSKSRGNVVDPDDLLERYGADALRYYLLRERPEGKDS 317 >gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. Catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. These class I enzymes are all monomers. However, in some species, MetRS functions as a homodimer, as a result of an additional C-terminal domain. These enzymes aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Enzymes in this subfamily share an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. MetRS has a significantly shorter insertion, which lacks the editing function. Length = 312 Score = 228 bits (583), Expect = 3e-60 Identities = 112/352 (31%), Positives = 169/352 (48%), Gaps = 62/352 (17%) Query: 6 KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65 K Y++T Y N H+GHA IIAD +AR+ R+ G +V F G D HG I A+ Sbjct: 1 KFYVTTPPPYANGSLHLGHALTHIIADFIARYKRMRGYEVPFLPGWDTHGLPIELKAERK 60 Query: 66 GV-------------TTKVFVDQNSRNFRDMADVLDISYD--DFIRTTEKRHHDTCRILW 110 G K FV++ S ++ L ISYD D TTE + +++ Sbjct: 61 GGRKKKTIWIEEFREDPKEFVEEMSGEHKEDFRRLGISYDWSDEYITTEPEYSKAVELIF 120 Query: 111 KKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLS 170 ++ +KG IY+G + V E +FF + Sbjct: 121 SRLYEKGLIYRGTH---------------PVRI------------------TEQWFFDMP 147 Query: 171 AYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPDDPQYIMYV 230 +++KLL I+P +N + ++++S L D ++SR+ + WG +P+D + V Sbjct: 148 KFKEKLLKALRRGK--IVPEHVKNRMEAWLES-LLDWAISRQRY-WGTPLPED---VFDV 200 Query: 231 WIDALTNYLTTTGYLDNPDGSKAK--FWPADLHVIGKDILRFHAIYWPAFLLSANLPLP- 287 W D+ L G L P+ + +PAD H+IGKDILR A +W L++ +P Sbjct: 201 WFDSGIGPL---GSLGYPEEKEWFKDSYPADWHLIGKDILRGWANFWITMLVALFGEIPP 257 Query: 288 KKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKD 338 K + HGF+L G+K+SKS GNVIDP +V+E+ G DALRY+L G D Sbjct: 258 KNLLVHGFVLDEGGQKMSKSKGNVIDPSDVVEKYGADALRYYLTSLAPYGDD 309 >gnl|CDD|36461 KOG1247, KOG1247, KOG1247, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 567 Score = 162 bits (411), Expect = 2e-40 Identities = 127/545 (23%), Positives = 226/545 (41%), Gaps = 50/545 (9%) Query: 6 KLYISTAIAYPNAQPHIGHAYEMII-ADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQN 64 + I++A+ Y N PH+G+ ++ ADV AR+ L G + L+ GTDE+G A Sbjct: 15 NILITSALPYVNNVPHLGNIIGSVLSADVFARYCPLRGPNTLYICGTDEYGTATETKALE 74 Query: 65 AGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISDKGDIYKGCY 124 G+T + D+ + + D I +D+F RTT K + C+ ++ K+ D G + + Sbjct: 75 EGLTPQELCDKYHGIHKVVYDWFKIDFDEFGRTTTKTQTEICQDIFSKLYDNGYLSEQTV 134 Query: 125 SGWYSLRDEAYYNDDEV--------YKGADGQY-------------YNAQHNPVQ----W 159 Y + + D V Y A G + Q Sbjct: 135 KQLYCEVCDTFLADRFVEGKCPFCGYDDARGDQCDKCGKLVNAAELKIPKCKICQAGPVV 194 Query: 160 MEEEGYFFRLSAYQDKLLSYYE-SHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGI 218 + + F L + +L + + E +N S++K GLK ++R WG Sbjct: 195 RQTQHLFLSLDKLEPRLEEWLRRTLVEGDWSQNAQNITRSWLKDGLKPRCITRD-LKWGT 253 Query: 219 KIPDD--PQYIMYVWIDALTNYLT-TTGYLDNPDGSKAKFWPADLHV-----IGKDILRF 270 +P + + YVW DA YL+ T Y D + K+W +V +GKD + F Sbjct: 254 PVPLEKFKDKVFYVWFDAPIGYLSITKNYTDEWE----KWWKNPENVELYQFMGKDNVPF 309 Query: 271 HAIYWPAFLLSA--NLPLPKKVFSHGFILHKGEKISKSLG-NVIDPIEVIEEVGVDALRY 327 H + +P L N + + + ++ ++ K SKS G V + RY Sbjct: 310 HTVIFPCSQLGTEENYTVVHHLSATEYLNYEDGKFSKSRGVGVFGNDAQDTGIPASVWRY 369 Query: 328 FLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESD 387 +L+ D + D +VN++L N +GN V+R + + Y+G++P T D Sbjct: 370 YLLYIRPESSDSAFSWDDFVLKVNSELLNNLGNFVNRVLKFVAAKYNGVVPE-MELTSGD 428 Query: 388 ESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTV 447 + +L + +L + M+ + AL + + ++Y +L + + RA TV Sbjct: 429 KKLLEDVNELLAKYVAAMEKVKLREALKTAMEISRRGNQYLQENTDNKLYEESRQRAGTV 488 Query: 448 LYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHK--TFDP 505 + + +I +++LL ++P + +I L E RL G H+ T P Sbjct: 489 IGLAANIIYLVSVLLYPYMPTTSAEILKQL-NLPETLFPDRFICRLLAG---HRIGTPSP 544 Query: 506 IFPRF 510 +F + Sbjct: 545 LFQKL 549 >gnl|CDD|153411 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of methionyl tRNA synthetases. This domain is found in methionyl tRNA synthetases (MetRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon (CAU). MetRS catalyzes the transfer of methionine to the 3'-end of its tRNA. Length = 129 Score = 151 bits (383), Expect = 6e-37 Identities = 53/129 (41%), Positives = 84/129 (65%), Gaps = 1/129 (0%) Query: 350 VNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQL 409 +N++LAN +GNLV+R+++M K + G++P G TE DE +L +L+E+ E M+ Sbjct: 1 INSELANNLGNLVNRTLNMASKYFGGVVPEFGGLTEEDEELLEEAEELLEEVAEAMEELE 60 Query: 410 IHRALAQVISLVSEVDRYFDAQKPWELKKT-NPDRASTVLYVTVEVIRQLAILLQAFVPK 468 +AL +++ L ++Y D PW+L K +P+R +TVLYV +E++R LAILL F+P+ Sbjct: 61 FRKALEEIMELARAANKYIDETAPWKLAKEEDPERLATVLYVLLELLRILAILLSPFMPE 120 Query: 469 LANKIFDIL 477 A KI D L Sbjct: 121 TAEKILDQL 129 >gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases. Leucyl tRNA synthetase (LeuRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 314 Score = 125 bits (317), Expect = 2e-29 Identities = 85/346 (24%), Positives = 140/346 (40%), Gaps = 66/346 (19%) Query: 6 KLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNA 65 K YI YP+ H+GH I D++AR+ R+ G +VLF G D G AA Sbjct: 1 KFYILVMFPYPSGALHVGHVRTYTIGDIIARYKRMQGYNVLFPMGFDAFGLPAENAAIKI 60 Query: 66 GVTTKVFVDQNSRNFRDMADVLDISYD--DFIRTTEKRHHDTCRILWKKISDKGDIYKGC 123 G + + + N + ++ + SYD T + ++ + L+ K+ +KG YK Sbjct: 61 GRDPEDWTEYNIKKMKEQLKRMGFSYDWRREFTTCDPEYYKFTQWLFLKLYEKGLAYKKE 120 Query: 124 YSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQW-MEEEGYFFRLS--AYQDKLLSYY 180 PV W + +F + S +++KLL Sbjct: 121 A-------------------------------PVNWCKLLDQWFLKYSETEWKEKLLKD- 148 Query: 181 ESHPEFILPIERRNEVISFVKSGLKD-LSLSRKTFDWGIKIPDDPQYIMYVWIDALTNYL 239 +E+ + V++ ++ + SR+ + WG IP M D+ Y Sbjct: 149 ---------LEKLDGWPEEVRAMQENWIGCSRQRY-WGTPIP--WTDTMESLSDSTWYYA 196 Query: 240 --TTTGYLDNPDGSKAKF-------W-PADLHVIGKDILRFH---AIYWPAFLLSANLPL 286 T L+ P +F W P D+++ GK+ H + + L L Sbjct: 197 RYTDAHNLEQPYEGDLEFDREEFEYWYPVDIYIGGKEHAPNHLLYSRFNHKALFDEGLVT 256 Query: 287 ---PKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFL 329 PK + G +L +GEK+SKS GNV+ P E I++ G DA R ++ Sbjct: 257 DEPPKGLIVQGMVLLEGEKMSKSKGNVVTPDEAIKKYGADAARLYI 302 >gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases. Valine amino-acyl tRNA synthetase (ValRS) catalytic core domain. This enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 382 Score = 113 bits (286), Expect = 9e-26 Identities = 90/393 (22%), Positives = 155/393 (39%), Gaps = 105/393 (26%) Query: 21 HIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNF 80 H+GHA I D++AR+ R+ G +VL+ GTD G IA Q V K+ ++ +R+ Sbjct: 17 HMGHALNNTIQDIIARYKRMKGYNVLWPPGTDHAG--IA--TQVV-VEKKLGIEGKTRH- 70 Query: 81 RDMADVLDISYDDFIRTT---EKRHHDTCRILWKKIS----------------------- 114 D+ ++F+ ++ R K++ Sbjct: 71 -------DLGREEFLEKCWEWKEESGGKIREQLKRLGASVDWSREYFTMDPGLSRAVQEA 123 Query: 115 -----DKGDIYKGCYSGWYSLRDEAYYNDDEV-YKGADGQYYNAQHNPVQWMEEEGYFFR 168 +KG IY+ + + +D EV + D ++ + + +F + Sbjct: 124 FVRLYEKGLIYRDNRLVNWCPKLRTAISDIEVCSRSGD---------VIEPLLKPQWFVK 174 Query: 169 LSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIP------- 221 + K L + +P +++++ ++D +SR+ + WG +IP Sbjct: 175 VKDLAKKALEAVKEGDIKFVPERMEKRYENWLEN-IRDWCISRQLW-WGHRIPAWYCKDG 232 Query: 222 -------------DDPQY----------------IMYVWIDALTNYLTTTGYLDNPDGSK 252 D ++ W + +T G+ + K Sbjct: 233 GHWVVAREEDEAIDKAAPEACVPCGGEELKQDEDVLDTWFSSSLWPFSTLGWPEETKDLK 292 Query: 253 AKFWPADLHVIGKDILRFHAIYWPA------FLLSANLPLPKKVFSHGFILHK-GEKISK 305 KF+P L V G DI+ F W A L+ LP K+V+ HG + + G K+SK Sbjct: 293 -KFYPTSLLVTGHDIIFF----WVARMIMRGLKLTGKLPF-KEVYLHGLVRDEDGRKMSK 346 Query: 306 SLGNVIDPIEVIEEVGVDALRYFLVREIACGKD 338 SLGNVIDP++VI+ G DALR+ L G+D Sbjct: 347 SLGNVIDPLDVIDGYGADALRFTLASAATQGRD 379 >gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 877 Score = 108 bits (271), Expect = 4e-24 Identities = 72/257 (28%), Positives = 115/257 (44%), Gaps = 20/257 (7%) Query: 231 WIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIY--WPAFLLSANLPLPK 288 W + +T G+ + K KF+P DL V G DI+ F L+ +P K Sbjct: 453 WFSSSLWPFSTLGWPEETPDLK-KFYPTDLLVTGHDIIFFWVARMIMRGLHLTGEVPF-K 510 Query: 289 KVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLK 347 V+ HG + +G K+SKS GNVIDP++VI++ G DALR+ L + G+D +D+ ++ Sbjct: 511 DVYIHGLVRDEQGRKMSKSKGNVIDPLDVIDKYGADALRFTLASLASPGRDINFDEKRVE 570 Query: 348 KRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQN 407 N N + N +R V M L D A + +D ILS + ++E+ E + N Sbjct: 571 GYRN--FLNKLWN-ATRFVLMNLDDLGPDDLDLLALSLADRWILSRLNETVKEVTEALDN 627 Query: 408 QLIHRALAQVISLVSE------VDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAIL 461 + + E D Y + KP L ++ + V+ L L Sbjct: 628 ----YRFDEAARALYEFIWNDFCDWYLELAKP-RLYGGEEEKRAAR-ATLYYVLDTLLRL 681 Query: 462 LQAFVPKLANKIFDILF 478 L F+P + +I+ L Sbjct: 682 LHPFMPFITEEIWQKLP 698 Score = 52.6 bits (126), Expect = 3e-07 Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHG 55 +++ I T H+GHA + D+LAR+ R+ G +VL+ GTD G Sbjct: 30 EDKPPFSIDTPPPNVTGSLHMGHALNYTLQDILARYKRMRGYNVLWPPGTDHAG 83 >gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases. Isoleucine amino-acyl tRNA synthetases (IleRS) catalytic core domain . This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. Length = 338 Score = 105 bits (264), Expect = 3e-23 Identities = 86/353 (24%), Positives = 148/353 (41%), Gaps = 73/353 (20%) Query: 15 YPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIA-KAAQNAGVTTKVFV 73 Y N PH GHA I+ D++ R+ + G V G D HG I K + G++ K Sbjct: 11 YANGLPHYGHALNKILKDIINRYKTMQGYYVPRRPGWDCHGLPIELKVEKELGISGK--- 67 Query: 74 DQNSRNFRDMADVLDISYDDFI---RTTEKRHHDTCRILWKKISDKGDIYKGCY------ 124 D+ + +F R R+ D ++++ D ++ Y Sbjct: 68 ----------KDIEKMGIAEFNAKCREFALRYVDEQEEQFQRLGVWVD-WENPYKTMDPE 116 Query: 125 ---SGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPV------QWMEEEGYFFRLSAYQDK 175 S W+ + + +Y+G + P+ QW F R++ +D+ Sbjct: 117 YMESVWWVFK--QLHEKGLLYRGYKVVPW-----PLIYRATPQW------FIRVTKIKDR 163 Query: 176 LLSYYES---HPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIP----DDP---- 224 LL + PE++ +N ++++ +D +SR+ + WG IP +D Sbjct: 164 LLEANDKVNWIPEWV-----KNRFGNWLE-NRRDWCISRQRY-WGTPIPVWYCEDCGEVL 216 Query: 225 ----QYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWPAF 278 ++ VW D+ + Y + + +PAD + G D R F+++ + Sbjct: 217 VRRVPDVLDVWFDSGSMPYAQLHYPFENEDFEEL-FPADFILEGSDQTRGWFYSLLLLST 275 Query: 279 LLSANLPLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLV 330 L P K V HGF+L G K+SKSLGN +DP EV+++ G DALR ++ Sbjct: 276 ALFGKAPY-KNVIVHGFVLDEDGRKMSKSLGNYVDPQEVVDKYGADALRLWVA 327 >gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933 Score = 101 bits (252), Expect = 7e-22 Identities = 80/270 (29%), Positives = 128/270 (47%), Gaps = 26/270 (9%) Query: 219 KIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWP 276 ++PD ++ VW D+ + T L + K AD ++ G D R F++ Sbjct: 524 RVPD----VLDVWFDSGS---TPYAVLHPRENLKFPALFADFYLEGSDQTRGWFYSSLLT 576 Query: 277 AFLLSANLPLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIAC 335 + L P K V +HGF+L KG K+SKSLGNV+DP +VI++ G D LR ++ Sbjct: 577 STALFGRAPY-KNVLTHGFVLDEKGRKMSKSLGNVVDPQDVIDKYGADILRLWVASS-DY 634 Query: 336 GKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPT--PGAFTESDESILSV 393 +D + + LK ++ I N R + L D+D P E D ILS Sbjct: 635 WEDLRFSDEILK--QVREVYRKIRN-TYRFLLGNLDDFDPKKDAVLPEELRELDRWILSR 691 Query: 394 CSRVLQEIRENMQNQLIHRALAQVISLVSEV--DRYFDAQKP--WELKKTNPDR--ASTV 447 + +++E+RE +N H+ + +++ VSE + Y D K + +PDR A T Sbjct: 692 LNSLVKEVREAYENYDFHKVVRALMNFVSEDLSNWYLDIIKDRLYTEAADSPDRRAAQTT 751 Query: 448 LYVTVEVIRQLAILLQAFVPKLANKIFDIL 477 LY +++ L LL +P A +I+ L Sbjct: 752 LY---HILKALVRLLAPILPFTAEEIWQNL 778 Score = 51.4 bits (123), Expect = 6e-07 Identities = 38/146 (26%), Positives = 60/146 (41%), Gaps = 20/146 (13%) Query: 15 YPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKI-AKAAQNAGVTTKVFV 73 Y N HIGHA I+ D++ R+ + G DV + G D HG I K + G+ K Sbjct: 59 YANGNIHIGHALNKILKDIIVRYKTMQGYDVPYVPGWDCHGLPIELKVEKKLGIGKKDIE 118 Query: 74 DQNSRNFRDM-----ADVLDISYDDFIR-----------TTEKRHHDTCRILW--KKISD 115 FR+ + +D + F R T ++ + W K++ + Sbjct: 119 SFGVEEFREKCREFALEQVDEQKEQFKRLGVWGDWENPYKTMDPSYEE-SVWWAFKELYE 177 Query: 116 KGDIYKGCYSGWYSLRDEAYYNDDEV 141 KG +Y+G +S R E + EV Sbjct: 178 KGLLYRGYKPVPWSPRCETALAEAEV 203 >gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 814 Score = 86.1 bits (213), Expect = 2e-17 Identities = 45/183 (24%), Positives = 76/183 (41%), Gaps = 8/183 (4%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61 + EK Y+ YP+ H+GH I DV+AR+ R+ G +VL G D G A Sbjct: 31 DKPEKFYVLVMFPYPSGALHVGHVRNYTIGDVIARYKRMQGYNVLHPMGWDAFGLPAENA 90 Query: 62 AQNAGVTTKVFVDQNSRNFRDMADVLDISYD---DFIRTTEKRHHDTCRILWKKISDKGD 118 A G + N + L S D +F T + ++ + + K+ +KG Sbjct: 91 AIKIGTDPAKWTYYNIAYMKKQLKSLGFSIDWRREFA-TCDPEYYKWIQWQFLKLYEKGL 149 Query: 119 IYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLS 178 Y+ + D +++V G + PV+ E +FF+++ Y D+LL Sbjct: 150 AYRKEAPVNWCPVDGTVLANEQVIDGGCWR----CGEPVEIKELTQWFFKITDYADELLD 205 Query: 179 YYE 181 + Sbjct: 206 DLD 208 Score = 67.6 bits (165), Expect = 7e-12 Identities = 53/240 (22%), Positives = 107/240 (44%), Gaps = 34/240 (14%) Query: 249 DGSKAKFW-PADLHVIGKDILRFH---AIYWPAFLLSANL----PLPKKVFSHGFILHK- 299 D + +W P DL++ G + H ++ L L KK+ + G +L + Sbjct: 517 DREEFNYWYPVDLYIGGIEHAVLHLLYFRFFHKALFDEGLVPKDEPFKKLITQGMVLGEE 576 Query: 300 GEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIG 359 GEK+SKS GNV+DP E +E+ G D +R +++ +D + + G+ G Sbjct: 577 GEKMSKSKGNVVDPEEAVEKYGADTVRLYIMFAAPPEQDLEWSESGV---------EGAR 627 Query: 360 NLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENM-QNQLIHRALAQVI 418 + R +++ + + ++ E + + R ++++ E+ Q + A+A ++ Sbjct: 628 RFLQRVWNLVKEHLEKLVEELT--KEQGKEDRWLLHRTIKKVTEDFEARQTFNTAIAALM 685 Query: 419 SLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILF 478 L++ + +Y L++T DR V E + LL F P +A ++++ L Sbjct: 686 ELLNALRKY--------LRRTEGDRK-----VLREALETWVRLLAPFAPHIAEELWEELG 732 >gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included. Length = 606 Score = 76.3 bits (188), Expect = 2e-14 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 14/117 (11%) Query: 219 KIPDDPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAF 278 + D ++ W + + +T GY +F+PAD+ + G D R W Sbjct: 486 QDED----VLDTWFSSGSWPFSTLGYPFTNTPEFKRFFPADMLLEGSDQTRG----WFYR 537 Query: 279 LLSANLPL----P-KKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFL 329 ++ L P K V HG + +G K+SKSLGNVIDP++VI++ G DALR +L Sbjct: 538 MIVLGTALTGSAPYKNVLVHGLVRDEQGRKMSKSLGNVIDPLDVIDKYGADALRLWL 594 Score = 52.8 bits (127), Expect = 2e-07 Identities = 32/144 (22%), Positives = 52/144 (36%), Gaps = 23/144 (15%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKI-AK 60 K + I HIGHA + D++ R+ R+ G DVL+ G D HG K Sbjct: 20 KGKPSFTIHDGPPNATGLLHIGHALNKTLKDIVIRYKRMQGFDVLWVPGWDHHGLPTEQK 79 Query: 61 AAQNAGVTTKV--------------------FVDQNSRNFRDMADVLDISYDDFIRTTEK 100 + G+ K + D+ F+ + D + F T + Sbjct: 80 VEKKLGIKGKKDRHKLGREKFREKCREWKMEYADEIRSQFKRLGVSGDWDREYF--TLDP 137 Query: 101 RHHDTCRILWKKISDKGDIYKGCY 124 ++ ++ DKG IY+G Sbjct: 138 GLEAAVWRVFVRLHDKGLIYRGKK 161 >gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase. Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Length = 143 Score = 65.2 bits (159), Expect = 4e-11 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Query: 15 YPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVD 74 PN HIGH ++ D LA+ +R G V D+ G I A G K FV+ Sbjct: 7 TPNGYLHIGHLRTIVTFDFLAQAYRKLGYKVRCIALIDDAGGLIGDPANKKGENAKAFVE 66 Query: 75 QNSRNFRDMADVL-DISYDDFIR-TTEKRHH 103 + ++ + + + D + TE H Sbjct: 67 RWIERIKEDVEYMFLQAADFLLLYETECDIH 97 Score = 28.2 bits (63), Expect = 5.4 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Query: 257 PADLHVIGKDILRFHAIYWPAFLLSANLPLPKKVFSHGFILHK-GEKISKSL 307 D+H+ G D L H L A P + G ++ G K+SKS Sbjct: 93 ECDIHLGGSDQL-GHIELGLELLKKAGGPARPFGLTFGRVMGADGTKMSKSK 143 >gnl|CDD|35654 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 937 Score = 65.0 bits (158), Expect = 5e-11 Identities = 58/270 (21%), Positives = 98/270 (36%), Gaps = 39/270 (14%) Query: 225 QYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWPAFLLSA 282 IM VW D+ +++ AD+++ G D R F + + + Sbjct: 542 TDIMDVWFDSGSSWSAVLDNEREH--------VADVYLEGVDQFRGWFQSSLLTSVAVQN 593 Query: 283 NLPLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIE------EVGVDALRYFLVR---- 331 P KKV HGF L G K+SKSLGNV+DP V + G D LR+++ Sbjct: 594 KAPY-KKVIVHGFTLDENGNKMSKSLGNVVDPTMVTDGSLKQPAYGADGLRFWVAGSENT 652 Query: 332 -EIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESI 390 E G D + +GNL + + D+ + Sbjct: 653 GESKIGPKILDQVDEKLIKFRNTFRFLLGNLQDFDGKQVKFPLKDL-------RYIDQYM 705 Query: 391 LSVCSRVLQEIRENMQNQLIHRALAQV----ISLVSEVDRYFDAQKP--WELKKTNPDRA 444 L +++ I E + + + + +S YFD K + K + R Sbjct: 706 LQQLDAIVKRIIELYNDYKFRKVVNDLQQFLQRNLSAF--YFDIVKDRLYCDKVGSESRR 763 Query: 445 STVLYVTVEVIRQLAILLQAFVPKLANKIF 474 S ++ LA ++ +P LA +++ Sbjct: 764 S-AQTTLHHLLHNLAHIISPILPHLAEEVW 792 Score = 33.4 bits (76), Expect = 0.16 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 6/74 (8%) Query: 17 NAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHG------QKIAKAAQNAGVTTK 70 N H+GHA I+ D++ R G L+ G D HG + ++ ++ G T Sbjct: 67 NGNLHLGHALNKILKDIINRILLAQGKSALYVPGWDCHGLPIESTKALSSLTESEGSRTP 126 Query: 71 VFVDQNSRNFRDMA 84 + + +R F D A Sbjct: 127 LEIRAKARIFADEA 140 >gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 995 Score = 61.8 bits (150), Expect = 5e-10 Identities = 76/299 (25%), Positives = 120/299 (40%), Gaps = 67/299 (22%) Query: 239 LTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFL------LSANLPLPKKVFS 292 +T G+ + K F+P L G DIL F W A + L+ LP K+V Sbjct: 529 FSTLGWPEETKDFK-NFYPLSLLETGHDILFF----WVARMVMLGLKLTGELPF-KEVLL 582 Query: 293 HGFIL-HKGEKISKSLGNVIDPIEVIE--------------------------------- 318 HG + G K+SKSLGNVIDP++VI+ Sbjct: 583 HGLVRDAHGRKMSKSLGNVIDPLDVIDGISLEKLHAKLLSGNLDPREVEKAKKGQKKDFP 642 Query: 319 ----EVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSRSVSMILKDYD 374 E G DALR+ L G+D + D L+ N + N R L + Sbjct: 643 NGIPECGTDALRFALCSYTTQGRD--INLDVLRVEGYRHFCNKLWNAT-RFALQRLG--E 697 Query: 375 GMIPTPGAFTESDES-----ILSVCSRVLQEIRENMQNQLIHRALAQVIS--LVSEVDRY 427 +P+P +ES ILS + ++E+ E+++ + H A + + + L D Y Sbjct: 698 NFVPSPTEDLSGNESLVDEWILSRLAEAVEEVNESLEARNFHLATSALYAFWLYDLCDVY 757 Query: 428 FDAQKP--WELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFVADENR 484 +A KP W + A VLY ++ + LL F+P + +++ L ++ Sbjct: 758 LEATKPLLWGDSEALAYEARRVLYRCLDNGLR---LLHPFMPFITEELWQRLPRRKGSK 813 Score = 44.1 bits (104), Expect = 1e-04 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 11/55 (20%) Query: 21 HIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQ 75 HIGHA + I D LAR++R+ G VL+ GTD +AG+ T+V V++ Sbjct: 91 HIGHALTVAIQDALARYNRMHGYQVLWVPGTD-----------HAGIATQVVVEK 134 >gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 876 Score = 59.2 bits (143), Expect = 2e-09 Identities = 54/189 (28%), Positives = 83/189 (43%), Gaps = 21/189 (11%) Query: 8 YISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGV 67 YI + YP+ HIGH I+D+LARF+R+ G +V+ G D G AA GV Sbjct: 60 YILSMFPYPSGALHIGHVRVYTISDILARFYRMKGYNVIHPMGWDAFGLPAENAAIERGV 119 Query: 68 TTKVFVDQNSRNFRDMADVLDISYD--DFIRTTEKRHHDTCRILWKKISDKGDIYKGCYS 125 + N + L IS+D I T E ++ + ++ K+ +KG Y Sbjct: 120 HPASWTINNIAKMKQQLKSLGISFDWDREISTCEPDYYKWTQWIFLKLFEKGLAY----- 174 Query: 126 GWYSLRDEAYYNDDEVYK--------GADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLL 177 + EA N D V K ADG + + V+ + +F + +AY +LL Sbjct: 175 -----QAEAEVNWDPVDKTVLANEQVDADGCSWRSGA-KVEKKKLRQWFIKTTAYAKRLL 228 Query: 178 SYYESHPEF 186 E+ PE+ Sbjct: 229 DGLETLPEW 237 Score = 50.4 bits (120), Expect = 1e-06 Identities = 58/305 (19%), Positives = 112/305 (36%), Gaps = 74/305 (24%) Query: 228 MYVWIDALTNYLTTTGYLD--NP----DGSKAKFW-PADLHVIGKDILRFHAIY---WPA 277 M ++D+ YL YLD NP D +KAK P D+++ GK+ H +Y Sbjct: 494 MDTFVDSSWYYLR---YLDPKNPEEPFDKAKAKKNMPVDVYIGGKEHAVLHLLYARFIAK 550 Query: 278 FLLSANL---PLP-KKVFSHGFILHKG--------------------------------- 300 FL + P K+ + G + K Sbjct: 551 FLKDIGVVSTAEPFTKLITQGMVRGKTFRTKESGKYLGPEEVQQVNDHQNKFVLKNDKEV 610 Query: 301 -----EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLK--KRVNAD 353 EK+SKS N +DP +V+ E GVD R +++ +++ + KR Sbjct: 611 VVVTYEKMSKSKHNGVDPADVVLEYGVDTTRLYILFAAPPRDPINWNESAIPGIKRWLQR 670 Query: 354 LANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQ-NQLIHR 412 + + ++ KD F + + ++++ E+ + ++ Sbjct: 671 IWALVSQILQARDDGKAKDL---KKLTDGFDAETRKLKETYNFFIKQVTEHYEVLFSLNT 727 Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANK 472 A++ ++ L + + + A K + +RA + L I+L F P +A++ Sbjct: 728 AISDMMGLTNALKK---ALKIVLVHSPEFERA----------LEALVIMLAPFAPHVASE 774 Query: 473 IFDIL 477 ++ L Sbjct: 775 LWSAL 779 >gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1080 Score = 51.6 bits (123), Expect = 5e-07 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 8/80 (10%) Query: 255 FWPADLHVIGKDILRFHAIYWPAFL-----LSANLPLPKKVFSHGFILHKGEKISKSLGN 309 F+P DL V GKD++ H + FL L PK + ++G ++ EK+SKS GN Sbjct: 661 FYPIDLRVSGKDLIPNHLTF---FLYNHVALFPEKKWPKGIRANGHLMLNSEKMSKSTGN 717 Query: 310 VIDPIEVIEEVGVDALRYFL 329 + + IE+ G D R L Sbjct: 718 FMTLEQAIEKFGADGTRLAL 737 Score = 37.3 bits (86), Expect = 0.011 Identities = 18/61 (29%), Positives = 31/61 (50%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61 K + K +++ Y N + H+GHA+ + + + + RL G +VLF G G I + Sbjct: 41 KSKPKFFVTFPYPYMNGRLHLGHAFSLSKVEFASGYERLQGKNVLFPFGFHCTGMPIKAS 100 Query: 62 A 62 A Sbjct: 101 A 101 >gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1070 Score = 49.2 bits (117), Expect = 3e-06 Identities = 53/232 (22%), Positives = 96/232 (41%), Gaps = 17/232 (7%) Query: 256 WPADLHVIGKDILR--FHAIYWPAFLLSANLPLPKKVFSHGFIL-HKGEKISKSLGNVID 312 +PAD G D R F+ + + L P K V +G +L G+K+SK L N D Sbjct: 553 FPADFIAEGLDQTRGWFYTLLVLSTALFGKPPF-KNVIVNGLVLAEDGKKMSKRLKNYPD 611 Query: 313 PIEVIEEVGVDALRYFLVRE-IACGKDGFYDKDGLK---KRVNADLANGIGNLVS----- 363 P +I + G DALR +L+ + ++ + ++G++ K V N LV Sbjct: 612 PSLIINKYGADALRLYLINSPVVRAENLKFKEEGVREVVKDVLLPWYNSYRFLVQNAALL 671 Query: 364 RSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSE 423 + + +D + + D IL+ ++ +RE M ++ + +++ + E Sbjct: 672 KKETGKDFVFDDSVTSSNVM---DRWILASTQSLVGFVREEMDQYRLYTVVPRLLKFIDE 728 Query: 424 VDRYFDAQKPWELKKTN-PDRASTVLYVTVEVIRQLAILLQAFVPKLANKIF 474 + ++ LK N L V EV+ L ++ F P I+ Sbjct: 729 LTNWYIRFNRRRLKGENGEHDCHNALNVLFEVLFTLVRVMAPFTPFFTEYIY 780 Score = 29.5 bits (66), Expect = 2.4 Identities = 16/54 (29%), Positives = 20/54 (37%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHG 55 K R K + PH GH I D++ R+ G V G D HG Sbjct: 35 KGRPKFTFYDGPPFATGLPHYGHILASTIKDIVTRYATQTGHHVERRFGWDTHG 88 >gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 464 Score = 46.0 bits (109), Expect = 3e-05 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 7/84 (8%) Query: 20 PHIGHAYEMIIADVLARFHRLDGLDVLFT---TGTDEHGQKIAKAAQNAGVTTKVFVDQN 76 HIGHA ++ DVL R+ R G V + T D+ KI A+ G++ + ++ Sbjct: 36 AHIGHARTYVVFDVLRRYLRYLGYKVTYVRNITDIDD---KIINRAREEGLSIREVAERY 92 Query: 77 SRNFRDMADVLDISY-DDFIRTTE 99 F + D L++ D R TE Sbjct: 93 IAAFFEDMDALNVLPPDIEPRATE 116 Score = 43.7 bits (103), Expect = 1e-04 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Query: 289 KVFSH-GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLV 330 K + H GF+ GEK+SKSLGN I +++++ + LR FL+ Sbjct: 254 KYWMHNGFLNIDGEKMSKSLGNFITVRDLLKKYDPEVLRLFLL 296 >gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase. Cysteinyl tRNA synthetase (CysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. Length = 213 Score = 42.2 bits (100), Expect = 3e-04 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 289 KVFSH-GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLV 330 + + H G + GEK+SKSLGN I + +++ + LR L+ Sbjct: 160 RYWLHTGHLTIDGEKMSKSLGNFITVRDALKKYDPEVLRLALL 202 Score = 37.2 bits (87), Expect = 0.011 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Query: 20 PHIGHAYEMIIADVLARFHRLDGLDVLFT---TGTDEHGQKIAKAAQNAGVTTKVFVDQN 76 HIGHA ++ DVL R+ G V + T D+ KI K A+ G++ K D Sbjct: 34 AHIGHARTYVVFDVLRRYLEDLGYKVRYVQNITDIDD---KIIKRAREEGLSWKEVADYY 90 Query: 77 SRNFRDMADVLDISYDDF 94 ++ F + L++ D Sbjct: 91 TKEFFEDMKALNVLPPDV 108 >gnl|CDD|110410 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain. This family includes only cysteinyl tRNA synthetases. Length = 301 Score = 40.4 bits (95), Expect = 0.001 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 1/82 (1%) Query: 20 PHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRN 79 HIGHA + DVL R+ + G DV F + KI K AQ G + + + Sbjct: 23 SHIGHARSAVAFDVLRRYLQALGYDVQFVQNFTDIDDKIIKRAQQQGESFRELAARFITA 82 Query: 80 FRDMADVLDISYDDF-IRTTEK 100 + D L++ D R TE Sbjct: 83 YTKDMDALNVLPPDLEPRVTEH 104 Score = 36.9 bits (86), Expect = 0.011 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 289 KVFSH-GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFL 329 K + H G ++ +GEK+SKSLGN + +V++ LRYFL Sbjct: 239 KYWLHNGHLMIEGEKMSKSLGNFLTIRDVLKRYDPRILRYFL 280 >gnl|CDD|153416 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of valyl tRNA synthetases. This domain is found in valyl tRNA synthetases (ValRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon. ValRS catalyzes the transfer of valine to the 3'-end of its tRNA. Length = 135 Score = 39.8 bits (94), Expect = 0.002 Identities = 27/123 (21%), Positives = 48/123 (39%), Gaps = 13/123 (10%) Query: 362 VSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLV 421 +R V M L+D D P + + +D ILS ++ ++E+ E ++N A + Sbjct: 19 AARFVLMNLEDDDEPEEDPESLSLADRWILSRLNKTVEEVTEALENYRFSEAATALYEFF 78 Query: 422 SEV--DRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDILFV 479 D Y + KP L + + V+ + LL F+P F+ Sbjct: 79 WNDFCDWYLELVKP-RLYGEDEEEKKAARATLYYVLETILRLLHPFMP----------FI 127 Query: 480 ADE 482 +E Sbjct: 128 TEE 130 >gnl|CDD|153408 cd07375, Anticodon_Ia_like, Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains. This domain is found in a variety of class Ia aminoacyl tRNA synthetases, C-terminal to the catalytic core domain. It recognizes and specifically binds to the anticodon of the tRNA. Aminoacyl tRNA synthetases catalyze the transfer of cognate amino acids to the 3'-end of their tRNAs by specifically recognizing cognate from non-cognate amino acids. Members include valyl-, leucyl-, isoleucyl-, cysteinyl-, arginyl-, and methionyl-tRNA synthethases. This superfamily also includes a domain from MshC, an enzyme in the mycothiol biosynthetic pathway. Length = 117 Score = 38.3 bits (89), Expect = 0.005 Identities = 20/110 (18%), Positives = 40/110 (36%), Gaps = 2/110 (1%) Query: 355 ANGIGNLVSRSVSMILKDYDGMIP--TPGAFTESDESILSVCSRVLQEIRENMQNQLIHR 412 A N + R +S K G P E+D +L+ ++ ++ Sbjct: 7 ARAFLNRLYRLLSFFRKALGGTQPKWDNELLEEADRELLARLQEFIKRTTNALEALDPTT 66 Query: 413 ALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILL 462 A+ ++ +E++ Y D KP + + VL + V+ +L Sbjct: 67 AVQELFKFTNELNWYLDELKPALQTEELREAVLAVLRAALVVLTKLLAPF 116 >gnl|CDD|145212 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K). This family includes only lysyl tRNA synthetases from prokaryotes. Length = 355 Score = 35.7 bits (83), Expect = 0.030 Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 295 FILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVR 331 +L G K+S S GN I E +E ++LR+ + R Sbjct: 271 ILLKGGGKMSSSKGNGITIEEWLEYAPPESLRFLMFR 307 >gnl|CDD|173900 cd00674, LysRS_core_class_I, catalytic core domain of class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity. Length = 353 Score = 34.6 bits (80), Expect = 0.058 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 287 PKKVFSHGFILHKG-EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDG 345 P + FI KG K+S S GNVI P + +E + LRY R K +D D Sbjct: 259 PPVPVMYEFIGLKGGGKMSSSKGNVITPSDWLEVAPPEVLRYLYARRKNPEKHIGFDLDI 318 Query: 346 LK 347 L+ Sbjct: 319 LR 320 Score = 28.4 bits (64), Expect = 4.8 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 2 KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLF 47 K +EK +++ I+ P+ HIG+ E+I AD++AR R G +V Sbjct: 16 KGKEKYVVASGIS-PSGHIHIGNFREVITADLVARALRDLGFEVRL 60 >gnl|CDD|31574 COG1384, LysS, Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]. Length = 521 Score = 34.8 bits (80), Expect = 0.060 Identities = 15/45 (33%), Positives = 21/45 (46%) Query: 287 PKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVR 331 P +L G K+S S GNVI + +E + LRY + R Sbjct: 262 PVPFVYEWILLKGGGKMSSSKGNVISLSDWLEVAPPEVLRYLIAR 306 >gnl|CDD|37218 KOG2007, KOG2007, KOG2007, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 586 Score = 32.3 bits (73), Expect = 0.29 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 289 KVFSH-GFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVR 331 F H G + GEK+SKSL N I E +++ LR + Sbjct: 291 NYFLHTGHLTINGEKMSKSLKNFITIKEALKKYSPRQLRLAFLL 334 Score = 29.2 bits (65), Expect = 2.7 Identities = 30/126 (23%), Positives = 47/126 (37%), Gaps = 11/126 (8%) Query: 3 EREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLD-GLDVLFTTGTDEHGQKIAKA 61 + YI Y ++ H+GHA + D+L R R G DV F + KI K Sbjct: 54 NKVTWYICGPTVYDSS--HMGHARSYVSFDILRRILRDYFGYDVTFVMNITDVDDKIIKR 111 Query: 62 AQNAGVT------TKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHDTCRILWKKISD 115 A+ + ++ F +DMA + + R +E + +KI D Sbjct: 112 ARKEEMGEKPLSLSERFCYYEEEFLQDMAALNVLPPTVQTRVSE--YVPQIIKFIQKIID 169 Query: 116 KGDIYK 121 G Y Sbjct: 170 NGYAYA 175 >gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 577 Score = 30.6 bits (69), Expect = 1.1 Identities = 18/49 (36%), Positives = 21/49 (42%) Query: 14 AYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAA 62 A P HIGH II D LAR G DV ++ G +I A Sbjct: 126 ANPTGPLHIGHLRNAIIGDSLARILEFLGYDVTRENYVNDWGTQIGMLA 174 >gnl|CDD|112744 pfam03945, Endotoxin_N, delta endotoxin, N-terminal domain. This family contains insecticidal toxins produced by Bacillus species of bacteria. During spore formation the bacteria produce crystals of this protein. When an insect ingests these proteins they are activated by proteolytic cleavage. The N terminus is cleaved in all of the proteins and a C terminal extension is cleaved in some members. Once activated the endotoxin binds to the gut epithelium and causes cell lysis leading to death. This activated region of the delta endotoxin is composed of three structural domains. The N-terminal helical domain is involved in membrane insertion and pore formation. The second and third domains are involved in receptor binding. Length = 224 Score = 29.9 bits (68), Expect = 1.8 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 4/83 (4%) Query: 396 RVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVI 455 +V Q I + + Q+ +RA+A++ L + D Y +A + WE N V Sbjct: 49 QVEQLIDQRISEQVRNRAIARLNGLGNSYDIYLEALEEWEKNPNNTRSREAV----RTRF 104 Query: 456 RQLAILLQAFVPKLANKIFDILF 478 L L +P A +++L Sbjct: 105 NILDSLFTNAIPSFAVSGYEVLL 127 >gnl|CDD|153412 cd07958, Anticodon_Ia_Leu_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases. This domain is found in leucyl tRNA synthetases (LeuRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain. In contrast to other class Ia enzymes, the anticodon is not used as an identity element in LeuRS (with exceptions such as Saccharomyces cerevisiae and some other eukaryotes). No anticodon-binding site can be defined for this family, which includes bacterial and eukaryotic mitochondrial members, as well as LeuRS from the archaeal Halobacteria. LeuRS catalyzes the transfer of leucine to the 3'-end of its tRNA. Length = 117 Score = 29.5 bits (67), Expect = 2.0 Identities = 19/93 (20%), Positives = 40/93 (43%), Gaps = 13/93 (13%) Query: 378 PTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELK 437 +E D+ + + ++++ E+++ + A+A ++ LV+ + +Y K Sbjct: 31 AAAAELSEEDKELRRKLHKTIKKVTEDIERLRFNTAIAALMELVNALYKYK--------K 82 Query: 438 KTNPDRASTVLYVTVEVIRQLAILLQAFVPKLA 470 K A V E + L +LL F P +A Sbjct: 83 KDAQHAA-----VLREALETLVLLLAPFAPHIA 110 >gnl|CDD|185675 cd00671, ArgRS_core, catalytic core domain of arginyl-tRNA synthetases. Arginyl tRNA synthetase (ArgRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. There are at least three subgroups of ArgRS. One type contains both characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The second subtype lacks the KMSKS motif; however, it has a lysine N-terminal to the HIGH motif, which serves as the functional counterpart to the second lysine of the KMSKS motif. A third group, which is found primarily in archaea and a few bacteria, lacks both the KMSKS motif and the HIGH loop lysine. Length = 212 Score = 29.1 bits (66), Expect = 2.8 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Query: 16 PNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTTKVFVDQ 75 P H+GH II D LAR G DV ++ G++I + K V++ Sbjct: 11 PTGPLHVGHLRNAIIGDSLARILEFLGYDVTREYYINDWGRQIGLLILSLEKWRK-LVEE 69 Query: 76 NSRNFRDMADVLDISYDDF 94 + + + LD+ +D + Sbjct: 70 SIKADLETYGRLDVRFDVW 88 >gnl|CDD|153415 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases. This domain is found in isoleucyl tRNA synthetases (IleRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon. This family includes bacterial, archaeal, and eukaryotic cytoplasmic members. IleRS catalyzes the transfer of isoleucine to the 3'-end of its tRNA. Length = 183 Score = 29.1 bits (66), Expect = 3.3 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 19/94 (20%) Query: 390 ILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEV---------DRYFDAQKPWELKKTN 440 ILS + +++E+ E M+ ++ A+ ++ + E+ R+ W + + Sbjct: 52 ILSRLNSLIKEVTEEMEAYDLYTAVRALLEFIDELTNWYIRRNRKRF------WGEEGDD 105 Query: 441 PDRAS-TVLYVTVEVIRQLAILLQAFVPKLANKI 473 A+ LY EV+ L+ L+ F P + +I Sbjct: 106 DKLAAYATLY---EVLLTLSRLMAPFTPFITEEI 136 >gnl|CDD|29363 cd01941, YeiC_kinase_like, YeiC-like sugar kinase. Found in eukaryotes and bacteria, YeiC-like kinase is part of the ribokinase/pfkB sugar kinase superfamily. Its oligomerization state is unknown at this time.. Length = 288 Score = 28.7 bits (64), Expect = 4.1 Identities = 16/76 (21%), Positives = 29/76 (38%), Gaps = 12/76 (15%) Query: 11 TAIAYPNAQPHIGHAYEMI------IADVLARFHRLDGLDVLF--TTGTDEHGQKIAKAA 62 + + + GH + IA+ LAR G+ V G D G+ I + + Sbjct: 16 VSGSLVPGTSNPGHVKQSPGGVGRNIAENLARL----GVSVALLSAVGDDSEGESILEES 71 Query: 63 QNAGVTTKVFVDQNSR 78 + AG+ + V + Sbjct: 72 EKAGLNVRGIVFEGRS 87 >gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as binding sites for downstream signaling molecules. HER3 binds the neuregulin ligands, NRG1 and NRG2. HER3 contains an impaired tyr kinase domain and relies on its heterodimerization partners for activity following ligand binding. The HER2-HER3 heterodimer constitutes a high affinity co-receptor capable of potent mitogenic signaling. HER3 participates in a signaling pathway involved in the proliferation, survival, adhesion, and motility of tumor cells. Length = 279 Score = 28.8 bits (64), Expect = 4.2 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Query: 136 YNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLSY 179 Y DD+ Y +Y+ P++WM E F +Q + SY Sbjct: 160 YPDDKKY------FYSEHKTPIKWMALESILFGRYTHQSDVWSY 197 >gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha -beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 254 Score = 28.7 bits (65), Expect = 4.3 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 13/68 (19%) Query: 370 LKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISLVSEVDRYFD 429 L D G + P FT E + L+EI+E + R + +YF+ Sbjct: 67 LSDSKGYVYDPDGFTG--EKL-----AELKEIKE------VRRGRVSEYAKKYGTAKYFE 113 Query: 430 AQKPWELK 437 +KPWE+ Sbjct: 114 GKKPWEVP 121 >gnl|CDD|29351 cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.. Length = 295 Score = 28.7 bits (64), Expect = 4.5 Identities = 20/82 (24%), Positives = 28/82 (34%), Gaps = 18/82 (21%) Query: 30 IADVLARFHRLDGLDVLFTT--GTDEHGQKIAKAAQNAGV------------TTKVFVDQ 75 +A LAR G F G DE G + + + AGV TT FV Sbjct: 34 VAVALARL----GGKAAFIGKVGDDEFGDFLLETLKEAGVDTRGIQFDPAAPTTLAFVTL 89 Query: 76 NSRNFRDMADVLDISYDDFIRT 97 ++ R + D + T Sbjct: 90 DADGERSFEFYRGPAADLLLDT 111 >gnl|CDD|132719 cd00630, RNAP_largest_subunit_C, Largest subunit of RNA polymerase (RNAP), C-terminal domain. RNA polymerase (RNAP) is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is the final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei, RNAP I, RNAP II, and RNAP III, for the synthesis of ribosomal RNA precursor, mRNA precursor, and 5S and tRNA, respectively. A single distinct RNAP complex is found in prokaryotes and archaea, which may be responsible for the synthesis of all RNAs. Structure studies revealed that prokaryotic and eukaryotic RNAPs share a conserved crab-claw-shape structure. The largest and the second largest subunits each make up one clamp, one jaw, and part of the cleft. The largest RNAP subunit (Rpb1) interacts with the second-largest RNAP subunit (Rpb2) to form the DNA entry and RNA exit channels in addition to the catalytic center of RNA synthesis. The region covered by this domain makes up part of the foot and jaw structures. In archaea, some photosynthetic organisms, and some organelles, this domain exists as a separate subunit, while it forms the C-terminal region of the RNAP largest subunit in eukaryotes and bacteria. Length = 158 Score = 28.5 bits (64), Expect = 4.8 Identities = 21/91 (23%), Positives = 36/91 (39%), Gaps = 13/91 (14%) Query: 305 KSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGNLVSR 364 K + N E++E +G++A R ++REI G+ V+ I ++++ Sbjct: 42 KEILNAASIHEMLEALGIEAARETIIREIQ----KVLASQGVS--VDRRHIELIADVMTY 95 Query: 365 SVSMILKDYDGMIPTPGAFTESDESILSVCS 395 S G+ T F S S L S Sbjct: 96 SG-----GLRGV--TRSGFRASKTSPLMRAS 119 >gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group. Length = 298 Score = 28.5 bits (64), Expect = 4.8 Identities = 7/29 (24%), Positives = 11/29 (37%) Query: 44 DVLFTTGTDEHGQKIAKAAQNAGVTTKVF 72 D +F G K A+ AG+ + Sbjct: 192 DAVFLAGYGGDAALFLKQAREAGLKVPIV 220 >gnl|CDD|38029 KOG2818, KOG2818, KOG2818, Predicted undecaprenyl diphosphate synthase [Lipid transport and metabolism]. Length = 263 Score = 28.3 bits (63), Expect = 5.2 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query: 301 EKISKSLGNVIDPIEVIEEVGVDALR--YFLVREIACGKDGFYDKDGLKKRVNADLANGI 358 +K K L VI P+E E DA ++ V + YD+ G+KKR + + I Sbjct: 62 KKGPKHLALVIHPVEDGEGSFSDASSIVFWAV-TVGIKYLSLYDRVGIKKRNMPVVRDEI 120 >gnl|CDD|32870 COG3056, COG3056, Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]. Length = 204 Score = 28.0 bits (62), Expect = 6.1 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 371 KDYDGMIPTPGAFTESDESILSVCSRVLQEIRENM-QNQLIHRALAQ 416 K+Y GAF+ S++ I V + VL ++ ++ Q+ + + Q Sbjct: 155 KNYRATYNVEGAFSASNDEIADVLNSVLNDVIADIAQDTEVANFIKQ 201 >gnl|CDD|31207 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism]. Length = 496 Score = 27.9 bits (62), Expect = 6.9 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 328 FLVREIACGKDGFYDKDGLKKRVNADLA 355 F V + C ++G D D L+ + +LA Sbjct: 179 FKVVVVKCDENGNVDLDDLRAKAEDNLA 206 >gnl|CDD|107255 cd01542, PBP1_TreR_like, Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of TreR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor. Length = 259 Score = 27.9 bits (63), Expect = 7.5 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 14/50 (28%) Query: 24 HAYEMIIA-------------DVLARFHRLDGLDVLFTTGTDEHGQKIAK 60 + Y+M++ ++LAR ++DG+ +L TT TDEH + I K Sbjct: 28 NGYQMLLMNTNFSIEKEIEALELLAR-QKVDGIILLATTITDEHREAIKK 76 >gnl|CDD|72944 cd04659, Piwi_piwi-like_ProArk, Piwi_piwi-like_ProArk: PIWI domain, Piwi-like subfamily found in Archaea and Bacteria. RNA silencing refers to a group of related gene-silencing mechanisms mediated by short RNA molecules, including siRNAs, miRNAs, and heterochromatin-related guide RNAs. The central component of the RNA-induced silencing complex (RISC) and related complexes is Argonaute. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the 5' anchoring of the guide RNA and the other, the catalytic site for slicing. This domain is also found in closely related proteins, including the Piwi subfamily, where it is believed to perform a crucial role in germline cells, via a similar mechanism.. Length = 404 Score = 27.7 bits (61), Expect = 7.7 Identities = 14/71 (19%), Positives = 22/71 (30%), Gaps = 11/71 (15%) Query: 228 MYVWIDALTNYLTTTGYLDNPDGSKAKFWPA-----------DLHVIGKDILRFHAIYWP 276 YV + L T G + + P DL + IL + W Sbjct: 319 TYVKLSDDEGLLWTHGSVPKYNTYPGMGTPRPLLLRRHSGNTDLEQLASQILGLTKLNWN 378 Query: 277 AFLLSANLPLP 287 +F + LP+ Sbjct: 379 SFQFYSRLPVT 389 >gnl|CDD|39627 KOG4426, KOG4426, KOG4426, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 656 Score = 27.6 bits (61), Expect = 9.0 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 16 PN--AQPHIGHAYEMIIADVLARFHRLDGLDVL 46 PN + H+GH II D L R G+DVL Sbjct: 197 PNIAKEMHVGHLRSTIIGDSLCRLLEFSGVDVL 229 >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. Many FGFR3 splice variants have been reported with the IIIb and IIIc isoforms being the predominant forms. FGFR3 IIIc is the isoform expressed in chondrocytes, the cells affected in dwarfism, while IIIb is expressed in epithelial cells. FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and FGF23. It is a negative regulator of long bone growth. In the cochlear duct and in the lens, FGFR3 is involved in differentiation while it appears to have a role in cell proliferation in epithelial cells. Germline mutations in FGFR3 are associated with skeletal disorders including several forms of dwarfism. Some missense mutations are associated with multiple myeloma and carcinomas of the bladder and cervix. Overexpression of FGFR3 is found in thyroid carcinoma. Length = 334 Score = 27.3 bits (60), Expect = 9.1 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 16/65 (24%) Query: 131 RDEAYYN----DDEVYKGADG---------QYYNAQHN---PVQWMEEEGYFFRLSAYQD 174 RD A N +D V K AD YY N PV+WM E F R+ +Q Sbjct: 158 RDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQS 217 Query: 175 KLLSY 179 + S+ Sbjct: 218 DVWSF 222 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.422 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 6,537,657 Number of extensions: 362362 Number of successful extensions: 972 Number of sequences better than 10.0: 1 Number of HSP's gapped: 939 Number of HSP's successfully gapped: 72 Length of query: 511 Length of database: 6,263,737 Length adjustment: 98 Effective length of query: 413 Effective length of database: 4,146,055 Effective search space: 1712320715 Effective search space used: 1712320715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.0 bits)