Query gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 174 No_of_seqs 110 out of 666 Neff 6.7 Searched_HMMs 39220 Date Sun May 29 15:05:18 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764466.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK04388 disulfide bond format 100.0 1.5E-39 3.8E-44 256.5 18.2 162 10-174 7-169 (172) 2 pfam02600 DsbB Disulfide bond 100.0 2.4E-38 6.1E-43 249.3 17.2 154 9-167 5-158 (159) 3 PRK02110 disulfide bond format 100.0 1.4E-36 3.5E-41 238.8 17.7 164 3-174 2-168 (169) 4 PRK01749 disulfide bond format 100.0 9.6E-36 2.4E-40 233.7 19.2 164 1-170 1-164 (175) 5 COG1495 DsbB Disulfide bond fo 100.0 1.8E-30 4.5E-35 202.1 17.4 158 9-174 10-170 (170) 6 PRK04307 putative disulfide ox 99.8 2.6E-16 6.6E-21 117.1 17.6 158 3-165 14-207 (220) 7 PRK03113 putative disulfide ox 99.7 4.6E-15 1.2E-19 109.6 15.5 120 20-167 16-136 (139) 8 PRK00611 putative disulfide ox 99.6 2.7E-14 6.9E-19 105.0 14.5 127 7-165 3-130 (135) 9 pfam07884 VKOR Vitamin K epoxi 88.3 1.8 4.7E-05 22.1 6.8 36 134-169 41-80 (138) 10 smart00756 VKc Family of likel 85.7 2.6 6.5E-05 21.2 7.2 68 83-169 10-84 (142) 11 COG0590 CumB Cytosine/adenosin 69.4 1.7 4.2E-05 22.3 0.6 10 36-45 83-92 (152) 12 cd01285 nucleoside_deaminase N 66.8 2.2 5.5E-05 21.6 0.7 11 36-46 72-82 (109) 13 PRK10860 tRNA-specific adenosi 63.8 2.6 6.5E-05 21.2 0.6 11 35-45 92-102 (178) 14 KOG0324 consensus 52.6 2.8 7.1E-05 21.0 -0.8 75 85-159 29-141 (214) 15 TIGR01478 STEVOR variant surfa 41.1 25 0.00063 15.3 3.4 28 146-174 276-303 (315) 16 PRK12437 prolipoprotein diacyl 35.8 30 0.00077 14.8 4.1 33 141-173 229-261 (269) 17 TIGR01477 RIFIN variant surfac 33.1 33 0.00085 14.5 3.5 15 160-174 367-381 (395) 18 PRK13882 conjugal transfer pro 31.8 33 0.00083 14.6 2.0 10 136-145 155-164 (232) 19 TIGR02502 type_III_YscX type I 29.3 17 0.00042 16.3 0.2 39 91-129 4-48 (126) 20 pfam02009 Rifin_STEVOR Rifin/s 28.5 40 0.001 14.0 2.8 14 161-174 262-275 (289) 21 KOG1018 consensus 28.2 20 0.0005 15.9 0.4 10 36-45 90-99 (169) 22 TIGR02611 TIGR02611 conserved 28.1 36 0.00091 14.3 1.7 20 142-161 96-115 (126) 23 pfam01790 LGT Prolipoprotein d 26.6 43 0.0011 13.8 3.6 28 143-173 230-257 (257) 24 pfam05879 RHD3 Root hair defec 22.0 53 0.0014 13.3 3.2 45 48-97 646-690 (741) 25 PTZ00042 stevor; Provisional 21.9 53 0.0014 13.3 7.0 32 142-174 261-292 (304) 26 PRK10332 hypothetical protein; 21.6 54 0.0014 13.2 3.1 23 121-143 66-88 (107) 27 PTZ00046 rifin; Provisional 20.9 56 0.0014 13.1 3.6 14 161-174 321-334 (348) No 1 >PRK04388 disulfide bond formation protein B; Provisional Probab=100.00 E-value=1.5e-39 Score=256.53 Aligned_cols=162 Identities=17% Similarity=0.213 Sum_probs=137.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 42169999999999999999999995278870557998999999999999999972011111012259999999999999 Q gi|255764466|r 10 ANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNM 89 (174) Q Consensus 10 ~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g~ 89 (174) +-+..-++.++.|.+++++|+|+||++|++|||||++||++|..+++.++++.++.. +.....+....+..+.+..|. T Consensus 7 s~R~~~ll~fl~~~~ll~~Aly~q~~~gL~PCpLCI~QR~~~~~igl~~li~~l~~p--~~~~~r~~~~~l~~l~a~~G~ 84 (172) T PRK04388 7 SFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALALLFLIGALHGP--RNAGGRKAYGVLAFIAAGVGM 84 (172) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHH T ss_conf 799999999999999999999999971888878899999999999999999999573--202599999999999999999 Q ss_pred HHHHHHHHHHHCCHHHCCCCCCCCCC-CCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99998658875000101122223431-00026588999984289998471003321014688999999999999999999 Q gi|255764466|r 90 TISVIHVGIECGIWEKNAICMNNSKI-ESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAML 168 (174) Q Consensus 90 ~ia~yH~giE~~~~~~~~~C~~~~~~-~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~~i~~~~~~ 168 (174) ++|.||+++|.++++++++|+++.++ .+..+..|.++.+. .++++|+|++|+|+|+|||+|++++|+++++++.+..+ T Consensus 85 ~~A~rhv~LQ~~p~~~~~~Cg~~l~~~~~~~p~~e~l~~~f-~g~g~Caev~W~flGlSmp~Wsli~F~~l~~~~l~~~~ 163 (172) T PRK04388 85 GIAARHVWVQIRPKDMMSSCGPPLSFLSETMGPFEVFRTVL-TGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGF 163 (172) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCHHHHHHHHH-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999993885347878871667762137999999985-68998685676516828899999999999999999999 Q ss_pred HHCCCC Q ss_conf 420379 Q gi|255764466|r 169 KISRKK 174 (174) Q Consensus 169 ~~~kkk 174 (174) |.+||| T Consensus 164 r~rr~~ 169 (172) T PRK04388 164 KARRRS 169 (172) T ss_pred HHCCCC T ss_conf 852568 No 2 >pfam02600 DsbB Disulfide bond formation protein DsbB. This family consists of disulfide bond formation protein DsbB from bacteria. The DsbB protein oxidizes the periplasmic protein DsbA which in turn oxidizes cysteines in other periplasmic proteins in order to make disulfide bonds. DsbB acts as a redox potential transducer across the cytoplasmic membrane and is an integral membrane protein. DsbB posses six cysteines four of which are necessary for it proper function in vivo. Probab=100.00 E-value=2.4e-38 Score=249.29 Aligned_cols=154 Identities=25% Similarity=0.377 Sum_probs=135.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH Q ss_conf 64216999999999999999999999527887055799899999999999999997201111101225999999999999 Q gi|255764466|r 9 LANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFN 88 (174) Q Consensus 9 ~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g 88 (174) .+++....+.++.|.++++.|+|+||++|++||+||++||+||+.++.+++++++.++ +..++.......+.++.| T Consensus 5 ~~~r~~~~~~~l~s~~~l~~Al~~q~~~gl~PC~LCi~QR~~~~~~~~~~li~~~~~~----~~~~~~~~~~~~~~~~~G 80 (159) T pfam02600 5 SSSRLLLLLLALASLALLLGALYFQYVLGLEPCPLCIYQRIAMLALALIGLLALLAGR----RGRRRLALLLALLLALAG 80 (159) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC----HHHHHHHHHHHHHHHHHH T ss_conf 0137999999999999999999999983888856599999999999999999998332----048999999999999999 Q ss_pred HHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999986588750001011222234310002658899998428999847100332101468899999999999999999 Q gi|255764466|r 89 MTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAM 167 (174) Q Consensus 89 ~~ia~yH~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~~i~~~~~ 167 (174) +++|.||+|+|+++|+++.+|++..+..+..+.+++.+++... .++|||++|+|+|+|||+||+++|+++++++.+.. T Consensus 81 ~~~a~~h~~le~~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~~-~~~C~~~~~~~lGlSma~wn~i~f~~l~i~~~~~~ 158 (159) T pfam02600 81 AGIALYHVGLQAGPWEGPPSCGALEGFPDWLPLDEWLPQVFAA-TGDCAEVAWTFLGLSMPGWSLVAFLLLALLLLLLL 158 (159) T ss_pred HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCC-CCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999828757899888864445537899999986689-99857534576584899999999999999999998 No 3 >PRK02110 disulfide bond formation protein B; Provisional Probab=100.00 E-value=1.4e-36 Score=238.77 Aligned_cols=164 Identities=20% Similarity=0.242 Sum_probs=132.3 Q ss_pred HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH Q ss_conf 8999996-421699999999999999999999952788705579989999999999999999720111110122599999 Q gi|255764466|r 3 KSLLSTL-ANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTL 81 (174) Q Consensus 3 ~~~~~~~-~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~ 81 (174) ||+.-.+ ..+..-+++++.|.+++++|+|+||++|++|||||++||++|..++++++++.+.+.+ ...+....+. T Consensus 2 ~~~~~~~~~~R~~~lli~l~~~~ll~~AlY~Qy~lgL~PC~LCI~QR~~~~~i~l~aLl~~~~~~~----~~~~~~~~l~ 77 (169) T PRK02110 2 NNLTLMLRRERRLLVLLGLVCLALVGGALYLQYVKGEDPCPLCIIQRYAFLLIAIFAFLAAAMRNW----RGVWVLEGLI 77 (169) T ss_pred CCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC----CHHHHHHHHH T ss_conf 843035407189999999999999999999999908876576999999999999999999974753----3899999999 Q ss_pred HHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCC--CCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHH Q ss_conf 99999999999986588750001011222234--3100026588999984289998471003321014688999999999 Q gi|255764466|r 82 GLLMFFNMTISVIHVGIECGIWEKNAICMNNS--KIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFL 159 (174) Q Consensus 82 ~l~~~~g~~ia~yH~giE~~~~~~~~~C~~~~--~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l 159 (174) .+.+..|..+|.||+|+|.++ +.+|+.++ ...+..+.+++.+.+.... ++|+|++|+|+|+|||+||+++|..+ T Consensus 78 ~l~a~~G~~~A~rhv~lq~~P---~~~Cg~~~l~~~~~~~pl~~~l~~lf~~~-g~Caev~w~flGLsmp~Wsli~F~~~ 153 (169) T PRK02110 78 VLSALGGIGTAGRHVYIQLNP---GFSCGIDALQPIVDSLPPAKWLPGVFKVD-GLCETPYPPILGLSLPGWALIAFVLI 153 (169) T ss_pred HHHHHHHHHHHHHHHHHHHCC---CCCCCCCHHHHHHHHCCHHHHHHHHHCCC-CCCCCCCCCCCCCCHHHHHHHHHHHH T ss_conf 999999999999999998299---84226871554875076999999997689-99898777621678999999999999 Q ss_pred HHHHHHHHHHHCCCC Q ss_conf 999999999420379 Q gi|255764466|r 160 SFITSIAMLKISRKK 174 (174) Q Consensus 160 ~~i~~~~~~~~~kkk 174 (174) +++..+.++|.+||. T Consensus 154 ~i~~l~~l~r~~kk~ 168 (169) T PRK02110 154 AVAVAVGLIRNRRRL 168 (169) T ss_pred HHHHHHHHHHHHHCC T ss_conf 999999999865126 No 4 >PRK01749 disulfide bond formation protein B; Provisional Probab=100.00 E-value=9.6e-36 Score=233.66 Aligned_cols=164 Identities=13% Similarity=0.144 Sum_probs=134.2 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH Q ss_conf 96899999642169999999999999999999995278870557998999999999999999972011111012259999 Q gi|255764466|r 1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMT 80 (174) Q Consensus 1 m~~~~~~~~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~ 80 (174) |++-+-+..+++..-++++++|++++++|+|+||++|++||||||+||+.+..++++++++.+.+ + ...++....+ T Consensus 1 m~~~l~~~~~~R~~wlll~~~~~~L~~~ALY~Q~~lgL~PCpLCI~QR~~~~~i~l~~Li~~i~p---~-~~~r~~~~~l 76 (175) T PRK01749 1 MLRFLNQCSRGRGAWLLLAFTALALELTALYFQHVMLLKPCVMCIYERVALFGILGAGLIGAIAP---K-TPLRYLALAI 76 (175) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC---C-CHHHHHHHHH T ss_conf 95899988875599999999999999999999998188864899999999999999999999786---2-1599999999 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHH Q ss_conf 99999999999998658875000101122223431000265889999842899984710033210146889999999999 Q gi|255764466|r 81 LGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLS 160 (174) Q Consensus 81 ~~l~~~~g~~ia~yH~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~ 160 (174) ..++++.|..+|.||+++|.++-+ ..+|+...++++..+.+|+++.+.... ++|+|++|+|+|+|||+|.+++|.+++ T Consensus 77 ~~~sa~~G~~~A~rhv~lQ~~P~~-~~~C~~~~~fp~~~Pl~e~lp~~F~g~-G~Caev~W~flGLSmp~W~li~F~~~~ 154 (175) T PRK01749 77 WLYSAWKGLQLAYEHTDLQLNPSP-FNTCDFFVRFPEWLPLDKWFPQVFVAS-GDCSERQWQFLGLEMPQWLVGIFAAYL 154 (175) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCHHHHHHHHHCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999808887-888896424412076999999997588-885767857765039989999999999 Q ss_pred HHHHHHHHHH Q ss_conf 9999999942 Q gi|255764466|r 161 FITSIAMLKI 170 (174) Q Consensus 161 ~i~~~~~~~~ 170 (174) +++.+.+.+. T Consensus 155 iv~vl~~~~~ 164 (175) T PRK01749 155 VVAVLVVISQ 164 (175) T ss_pred HHHHHHHHHH T ss_conf 9999999999 No 5 >COG1495 DsbB Disulfide bond formation protein DsbB [Posttranslational modification, protein turnover, chaperones] Probab=99.97 E-value=1.8e-30 Score=202.06 Aligned_cols=158 Identities=20% Similarity=0.294 Sum_probs=127.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH Q ss_conf 64216999999999999999999999527887055799899999999999999997201111101225999999999999 Q gi|255764466|r 9 LANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFN 88 (174) Q Consensus 9 ~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g 88 (174) ..+....+..++.+...+.+|+|+||++|++|||||++||++|+.++.++.++......++ ........++.| T Consensus 10 ~~r~~~ll~~~~~~~~~~~~al~fq~i~g~~PC~LC~~QR~~~~~~~~i~~l~~~~~~~~~-------~r~~~~~l~l~g 82 (170) T COG1495 10 FSRLLWLLLALLGLALALLAALYFQYILGLEPCPLCLYQRIAMYGLGVILLLALLIGPLNR-------LRLYGLALALIG 82 (170) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHH-------HHHHHHHHHHHH T ss_conf 7899999999999999999999999981888719799999999999999999999485264-------899999999999 Q ss_pred HHHHHHHHHHHHCCHHHC-CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC--CHHHHHCCCHHHHHHHHHHHHHHHHHH Q ss_conf 999998658875000101-12222343100026588999984289998471--003321014688999999999999999 Q gi|255764466|r 89 MTISVIHVGIECGIWEKN-AICMNNSKIESITSTVDLLTQMEQENIPSCNK--TTLYVLGLSLAFWNIIVSFFLSFITSI 165 (174) Q Consensus 89 ~~ia~yH~giE~~~~~~~-~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~e--v~w~flGlSma~wn~i~~~~l~~i~~~ 165 (174) ++.+.||+|.|..+|++| .+|+....++. ..+.+........+.++|+| ..|+++|+|||+||+++++..+++... T Consensus 83 ~~~giy~a~~~~~~~~~p~~~C~~~~~f~~-~~~~~~~~~~~~~~~~~C~~~~~~~~~Lglsm~~w~~~~~~~~~~~l~~ 161 (170) T COG1495 83 AGLGIYHAGEHVVLQLGPFATCSFGLTFPE-WLPLGKWAPLVFQGTGSCSEPVAAWRLLGLSMPPWLLLIFFALLLLLLL 161 (170) T ss_pred HHHHHHHHHHHHHHCCCCHHHHCCCCCCHH-CCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999998861586233303212201-0327776676745888865644046760587999999999999999999 Q ss_pred HHHHHCCCC Q ss_conf 999420379 Q gi|255764466|r 166 AMLKISRKK 174 (174) Q Consensus 166 ~~~~~~kkk 174 (174) ..++.++|+ T Consensus 162 ~~~~~~~~~ 170 (170) T COG1495 162 LLFRKKRKK 170 (170) T ss_pred HHHHHHHCC T ss_conf 998764069 No 6 >PRK04307 putative disulfide oxidoreductase; Provisional Probab=99.75 E-value=2.6e-16 Score=117.13 Aligned_cols=158 Identities=13% Similarity=0.169 Sum_probs=106.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHH-H Q ss_conf 899999642169999999999999999-99999527887055799899999999999999997201111101225999-9 Q gi|255764466|r 3 KSLLSTLANIPLPRIILLNISGVIVCF-LMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLM-T 80 (174) Q Consensus 3 ~~~~~~~~~~~l~li~~l~~~~ll~~A-~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~-~ 80 (174) +++-++-+++..-++...+++++++.| +||||++++.||.+|+|||.....++.-++++.+.+.|. ..|...+ . T Consensus 14 ~~l~~~q~~R~~Wlll~~~~~~L~~~A~~~FQ~~l~m~PC~~CVY~R~A~~~i~~~glI~~I~P~n~----ilrligy~l 89 (220) T PRK04307 14 DTLVRWQDQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMAIGGVIAAINPKNI----ILKLIGYIA 89 (220) T ss_pred HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHH----HHHHHHHHH T ss_conf 8999857205089999999999999999999999836789999999999999999999998181468----999999999 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCH-HHC----CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCH--------------- Q ss_conf 99999999999998658875000-101----1222234310002658899998428999847100--------------- Q gi|255764466|r 81 LGLLMFFNMTISVIHVGIECGIW-EKN----AICMNNSKIESITSTVDLLTQMEQENIPSCNKTT--------------- 140 (174) Q Consensus 81 ~~l~~~~g~~ia~yH~giE~~~~-~~~----~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~--------------- 140 (174) .......|...|..-.+++...- +.| .+|+..++++..++.++++++...+. ++|.+-+ T Consensus 90 af~G~i~G~~~sikL~~ih~a~~~~~p~fg~~~Cs~~P~FP~~LPLheW~P~~F~PT-GdCG~D~P~vp~~~~Ls~~Q~~ 168 (220) T PRK04307 90 AFYGSILGIKFSIKLNGIHHAVHNEDPLFGVQGCSTDPTFPFNLPLAEWAPEWFKPT-GDCGYDAPIVPDGVTLSSVQQW 168 (220) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-CCCCCCCCCCCCCCCHHHHHHH T ss_conf 999999999999998368998717995234476728899988887899869986647-7667899899986413789999 Q ss_pred ----------HHHHC----CCHHHHHHHHHHHHHHHHHH Q ss_conf ----------33210----14688999999999999999 Q gi|255764466|r 141 ----------LYVLG----LSLAFWNIIVSFFLSFITSI 165 (174) Q Consensus 141 ----------w~flG----lSma~wn~i~~~~l~~i~~~ 165 (174) |...+ .+||...+|.+....++... T Consensus 169 fv~~y~~~~gWyLip~~kF~nMA~c~~iaf~~~~v~L~~ 207 (220) T PRK04307 169 FVDLYQQSEGWYLLPPWHFMNMAQACLLAFGVCLVLLLV 207 (220) T ss_pred HHHCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 874235678526746066720999999999999999999 No 7 >PRK03113 putative disulfide oxidoreductase; Provisional Probab=99.68 E-value=4.6e-15 Score=109.64 Aligned_cols=120 Identities=15% Similarity=0.110 Sum_probs=84.3 Q ss_pred HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999952788705579989999999999999999720111110122599999999999999999865887 Q gi|255764466|r 20 LNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIE 99 (174) Q Consensus 20 l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g~~ia~yH~giE 99 (174) +.+.......+|+-+++|++||+||+|||+..|-..++..++.+.+..... + ...-.++.|..+|.||..+| T Consensus 16 ~va~~ATlGSLyfSEv~~~~PC~LCWyQRI~MYPL~iiLgia~~r~D~~v~----~----Y~lpLs~iG~~ia~YH~~lq 87 (139) T PRK03113 16 GASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVVKKDYRIA----S----YSLPIASIGACISLYHYAIQ 87 (139) T ss_pred HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEE----E----HHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999708987189999999999999999999972466723----1----15599999999999999999 Q ss_pred HCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHC-CCHHHHHHHHHHHHHHHHHHHH Q ss_conf 5000101122223431000265889999842899984710033210-1468899999999999999999 Q gi|255764466|r 100 CGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLG-LSLAFWNIIVSFFLSFITSIAM 167 (174) Q Consensus 100 ~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flG-lSma~wn~i~~~~l~~i~~~~~ 167 (174) +....+...+.++ .++|+......+| +|+|-.+++.|..+.++..+.. T Consensus 88 ~~p~~~~~~~~c~--------------------~vpCs~~y~~~fGfItIP~lal~AF~~I~vl~~~~~ 136 (139) T PRK03113 88 KIAAFSAAGAACG--------------------RVPCTGEYINWFGFVTIPFLALIGFITIAVCSFIVI 136 (139) T ss_pred HCCCCCCCCCCCC--------------------CCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 8066654367788--------------------999877888772671478899999999999999987 No 8 >PRK00611 putative disulfide oxidoreductase; Provisional Probab=99.62 E-value=2.7e-14 Score=104.99 Aligned_cols=127 Identities=13% Similarity=0.180 Sum_probs=81.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH Q ss_conf 99642169999999999999999999995278870557998999999999999999972011111012259999999999 Q gi|255764466|r 7 STLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMF 86 (174) Q Consensus 7 ~~~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~ 86 (174) +-..+..+...-.++.++.++ ++|+-+++|++||+||+|||+..|-..++..++.+.+..... + ...-.++ T Consensus 3 ~~~~~~~L~~Aw~va~~AtlG-SLyfSEv~~~~PC~LCWyQRI~MYPL~iiLgia~~r~D~~v~----~----Y~lpLs~ 73 (135) T PRK00611 3 KFLRSYALYFAWLISCIGTLM-SIYYSYILNVEPCVLCYYQRICLFPLVVILGIAAYREDSSIK----I----YALPLAL 73 (135) T ss_pred HHHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEE----E----HHHHHHH T ss_conf 689985999999999999999-999999628987378999999999999999999961677633----2----0779999 Q ss_pred HHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHC-CCHHHHHHHHHHHHHHHHHH Q ss_conf 99999998658875000101122223431000265889999842899984710033210-14688999999999999999 Q gi|255764466|r 87 FNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLG-LSLAFWNIIVSFFLSFITSI 165 (174) Q Consensus 87 ~g~~ia~yH~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flG-lSma~wn~i~~~~l~~i~~~ 165 (174) .|..+|.||..+|+-. +....|. +.++|++. +..+| +|+|-.+++.|..++++..+ T Consensus 74 iG~~is~YH~~lq~~p-~~~~~~c---------------------~~v~C~~~-~~~fGfItIP~lal~AF~~I~~ll~l 130 (135) T PRK00611 74 LGFGIAIYQVCLQEIP-GMTLDIC---------------------GRVSCSTK-LFLFGFITIPMASAVAFCAIACLLVL 130 (135) T ss_pred HHHHHHHHHHHHHHCC-CCCCCCC---------------------CCCCCCCC-CHHCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999826-5457778---------------------89998875-23406046998999999999999987 No 9 >pfam07884 VKOR Vitamin K epoxide reductase family. Vitamin K epoxide reductase (VKOR) recycles reduced vitamin K, which is used subsequently as a co-factor in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. VKORC1 is a member of a large family of predicted enzymes that are present in vertebrates, Drosophila, plants, bacteria and archaea. Four cysteine residues and one residue, which is either serine or threonine, are identified as likely active-site residues. In some plant and bacterial homologues the VKORC1 homologous domain is fused with domains of the thioredoxin family of oxidoreductases. Probab=88.30 E-value=1.8 Score=22.06 Aligned_cols=36 Identities=14% Similarity=0.368 Sum_probs=21.2 Q ss_pred CCCCCCH----HHHHCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9847100----33210146889999999999999999994 Q gi|255764466|r 134 PSCNKTT----LYVLGLSLAFWNIIVSFFLSFITSIAMLK 169 (174) Q Consensus 134 ~~C~ev~----w~flGlSma~wn~i~~~~l~~i~~~~~~~ 169 (174) .+||+|. =+++|+..+.+-+..+..+..+......+ T Consensus 41 ~~C~~V~~S~~a~~fGiP~s~~G~~~y~~~~~l~~~~~~~ 80 (138) T pfam07884 41 VSCSKVLNSPWATIFGIPNSLLGILAYLVVLLLGVLGLAG 80 (138) T ss_pred CCHHHHHCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCC T ss_conf 8867574576598729972789999999999999999725 No 10 >smart00756 VKc Family of likely enzymes that includes the catalytic subunit of vitamin K epoxide reductase. Bacterial homologues are fused to members of the thioredoxin family of oxidoreductases. Probab=85.73 E-value=2.6 Score=21.19 Aligned_cols=68 Identities=19% Similarity=0.308 Sum_probs=33.8 Q ss_pred HHHHHHHHHHHHHHHHHHCCHHHC---CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHH----HHHCCCHHHHHHHH Q ss_conf 999999999998658875000101---12222343100026588999984289998471003----32101468899999 Q gi|255764466|r 83 LLMFFNMTISVIHVGIECGIWEKN---AICMNNSKIESITSTVDLLTQMEQENIPSCNKTTL----YVLGLSLAFWNIIV 155 (174) Q Consensus 83 l~~~~g~~ia~yH~giE~~~~~~~---~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w----~flGlSma~wn~i~ 155 (174) +..+.|...|.|-...|++.-++| +.|+-+ +..+||+|.= +++|+..|-+-+.. T Consensus 10 ~l~~iGl~~S~yL~~~~~~~~~~~~~~~~C~i~-------------------~~~~C~~V~~S~ys~~fGiP~~~~G~~~ 70 (142) T smart00756 10 ILGLIGLLASLYLTYEKLTLLEDPDYVASCDIN-------------------PVVSCGKVLSSPYASIFGIPLSLLGIAA 70 (142) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-------------------CCCCCHHHHCCHHHHHCCCCHHHHHHHH T ss_conf 999999999999999999743599878788989-------------------8878053646774986299608999999 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999999994 Q gi|255764466|r 156 SFFLSFITSIAMLK 169 (174) Q Consensus 156 ~~~l~~i~~~~~~~ 169 (174) +..+..+......+ T Consensus 71 y~~~l~l~~~~~~~ 84 (142) T smart00756 71 YLVVLALAVLGLLG 84 (142) T ss_pred HHHHHHHHHHHHCC T ss_conf 99999999999746 No 11 >COG0590 CumB Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis] Probab=69.37 E-value=1.7 Score=22.31 Aligned_cols=10 Identities=30% Similarity=0.899 Sum_probs=7.7 Q ss_pred HCCCCHHHHH Q ss_conf 2788705579 Q gi|255764466|r 36 GGYPPCDLCI 45 (174) Q Consensus 36 ~gl~PC~LCi 45 (174) .-+|||+||. T Consensus 83 vT~EPC~MCa 92 (152) T COG0590 83 VTLEPCPMCA 92 (152) T ss_pred EECCHHHHHH T ss_conf 8668289999 No 12 >cd01285 nucleoside_deaminase Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protei Probab=66.79 E-value=2.2 Score=21.63 Aligned_cols=11 Identities=27% Similarity=0.854 Sum_probs=7.2 Q ss_pred HCCCCHHHHHH Q ss_conf 27887055799 Q gi|255764466|r 36 GGYPPCDLCIQ 46 (174) Q Consensus 36 ~gl~PC~LCi~ 46 (174) --+|||++|.. T Consensus 72 ~TlEPC~mC~~ 82 (109) T cd01285 72 TTLEPCPMCAG 82 (109) T ss_pred CCCCCHHHHHH T ss_conf 48898599999 No 13 >PRK10860 tRNA-specific adenosine deaminase; Provisional Probab=63.77 E-value=2.6 Score=21.18 Aligned_cols=11 Identities=27% Similarity=0.718 Sum_probs=8.5 Q ss_pred HHCCCCHHHHH Q ss_conf 52788705579 Q gi|255764466|r 35 VGGYPPCDLCI 45 (174) Q Consensus 35 ~~gl~PC~LCi 45 (174) +.-+|||++|. T Consensus 92 YVTLEPC~MCa 102 (178) T PRK10860 92 YVTLEPCVMCA 102 (178) T ss_pred EEECCCCHHHH T ss_conf 96548768899 No 14 >KOG0324 consensus Probab=52.57 E-value=2.8 Score=20.96 Aligned_cols=75 Identities=17% Similarity=0.216 Sum_probs=43.0 Q ss_pred HHHHHHHHHHHHHHHHC---------C--HHHCCCCCCCCCCC--------------CCCCHHHHHHHHHCCCCCC---- Q ss_conf 99999999986588750---------0--01011222234310--------------0026588999984289998---- Q gi|255764466|r 85 MFFNMTISVIHVGIECG---------I--WEKNAICMNNSKIE--------------SITSTVDLLTQMEQENIPS---- 135 (174) Q Consensus 85 ~~~g~~ia~yH~giE~~---------~--~~~~~~C~~~~~~~--------------~~~~~~~l~~~l~~~~~~~---- 135 (174) .....++++||.|||-+ . ..+..+|.++...+ ...+..+.++.+...-.++ T Consensus 29 y~~~lGlGIfHSgIeV~g~EyayG~h~~~~sGIfe~~P~~~~~f~fr~sI~lG~Td~~~~~v~~~le~L~~ey~G~~YhL 108 (214) T KOG0324 29 YLYWLGLGIFHSGIEVHGVEYAYGAHEYPSSGIFEVEPGNCPEFTFRKSILLGSTDLTEDDVRRILEELSEEYRGNSYHL 108 (214) T ss_pred HHHHHCCEEEEEEEEEECEEEECCCCCCCCCCEEEECCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEHH T ss_conf 55431110675037981214423654468887686489888888645778834777899999999999876527852213 Q ss_pred --------CCCCHHHHHCCCHHHH-HHHHHHHH Q ss_conf --------4710033210146889-99999999 Q gi|255764466|r 136 --------CNKTTLYVLGLSLAFW-NIIVSFFL 159 (174) Q Consensus 136 --------C~ev~w~flGlSma~w-n~i~~~~l 159 (174) |+++.-.+-|=++|+| |=+..++. T Consensus 109 ~~kNCNHFsn~la~~Ltgk~IP~winrLa~~~~ 141 (214) T KOG0324 109 LTKNCNHFSNELALQLTGKKIPSWVNRLARAGL 141 (214) T ss_pred HHHCCCHHHHHHHHHHCCCCCCHHHHHHHHHHH T ss_conf 341540058999999718986278998888765 No 15 >TIGR01478 STEVOR variant surface antigen, stevor family; InterPro: IPR006374 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see . This entry represents the stevor (short for "subtelomeric variable open reading frame") family of predicted variant surface antigens. This is the third largest variant surface antigen family in P. falciparum, with 33 genes identified in the genome of this parasite . The function of these proteins is not known, but they are expressed during several stages of the parasite life-cycle and may play a variety of roles in parasite survival and infection .. Probab=41.12 E-value=25 Score=15.27 Aligned_cols=28 Identities=21% Similarity=0.259 Sum_probs=17.8 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 14688999999999999999999420379 Q gi|255764466|r 146 LSLAFWNIIVSFFLSFITSIAMLKISRKK 174 (174) Q Consensus 146 lSma~wn~i~~~~l~~i~~~~~~~~~kkk 174 (174) -=||.- +++-+.+.++.++.+++.+||| T Consensus 276 yGIAAl-VLi~L~V~LIiLYIWLYrRRK~ 303 (315) T TIGR01478 276 YGIAAL-VLIILTVVLIILYIWLYRRRKK 303 (315) T ss_pred HHHHHH-HHHHHHHHHHHHHHHHHHHCCH T ss_conf 589999-9999999999998888564030 No 16 >PRK12437 prolipoprotein diacylglyceryl transferase; Reviewed Probab=35.83 E-value=30 Score=14.76 Aligned_cols=33 Identities=15% Similarity=0.159 Sum_probs=19.4 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 332101468899999999999999999942037 Q gi|255764466|r 141 LYVLGLSLAFWNIIVSFFLSFITSIAMLKISRK 173 (174) Q Consensus 141 w~flGlSma~wn~i~~~~l~~i~~~~~~~~~kk 173 (174) ..+.|+|+++|-.+..+...++..+...|+.+| T Consensus 229 ~~~~~lt~~Q~lSl~~i~~G~~ll~~~~rr~~k 261 (269) T PRK12437 229 MLTGNLRMAQVMSILGIIIGLVLLIYIRRRGLK 261 (269) T ss_pred HHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 874781199999999999999999999862655 No 17 >TIGR01477 RIFIN variant surface antigen, rifin family; InterPro: IPR006373 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see . This entry represents the rifin family of variant surface antigens, encoded by the rif (short for "repetetive interspersed family") genes. This is the largest variant surface antigen family in P. falciparum, with roughly 150 genes present in the genome of this parasite . The function of these proteins is not yet known, but rifins are strongly immunogenic and high levels of anti-rifin antibodies are correlated with rapid parasite clearance and asymptomatic infections . . Probab=33.15 E-value=33 Score=14.50 Aligned_cols=15 Identities=27% Similarity=0.401 Sum_probs=7.4 Q ss_pred HHHHHHHHHHHCCCC Q ss_conf 999999999420379 Q gi|255764466|r 160 SFITSIAMLKISRKK 174 (174) Q Consensus 160 ~~i~~~~~~~~~kkk 174 (174) .-+-+|.++||+||| T Consensus 367 IMvIIYLILRYRRKK 381 (395) T TIGR01477 367 IMVIIYLILRYRRKK 381 (395) T ss_pred HHHHHHHHHHHHHHH T ss_conf 999999987543112 No 18 >PRK13882 conjugal transfer protein TrbP; Provisional Probab=31.77 E-value=33 Score=14.56 Aligned_cols=10 Identities=0% Similarity=-0.017 Sum_probs=4.0 Q ss_pred CCCCHHHHHC Q ss_conf 4710033210 Q gi|255764466|r 136 CNKTTLYVLG 145 (174) Q Consensus 136 C~ev~w~flG 145 (174) |+++.|+-.. T Consensus 155 ~~~~~~~~~~ 164 (232) T PRK13882 155 FRRPAWAAAA 164 (232) T ss_pred HCCCCHHHHH T ss_conf 6285069999 No 19 >TIGR02502 type_III_YscX type III secretion protein, YscX family; InterPro: IPR012672 Members of this family are encoded within bacterial type III secretion gene clusters. Among all species with type III secretion, those with this protein are found among those that target animal rather than plant cells. The member of this family in Yersinia was shown by mutation to be required for type III secretion of Yops effector proteins and therefore is believed to be part of the secretion machinery .. Probab=29.32 E-value=17 Score=16.31 Aligned_cols=39 Identities=15% Similarity=0.087 Sum_probs=18.9 Q ss_pred HH-HHHHHHHHCC--HHHCCCCCCCC---CCCCCCCHHHHHHHHH Q ss_conf 99-9865887500--01011222234---3100026588999984 Q gi|255764466|r 91 IS-VIHVGIECGI--WEKNAICMNNS---KIESITSTVDLLTQME 129 (174) Q Consensus 91 ia-~yH~giE~~~--~~~~~~C~~~~---~~~~~~~~~~l~~~l~ 129 (174) ++ .+|+|||+-- -.++..|+-.. -.++.-+++.=++.+. T Consensus 4 v~ta~hiGIE~L~~~s~eE~~~~LP~Ry~L~PDG~~VeTH~~~LY 48 (126) T TIGR02502 4 VSTALHIGIEKLTAISAEEVDTDLPERYALLPDGQPVETHLERLY 48 (126) T ss_pred CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHC T ss_conf 123011236664033047788987611268876786224676405 No 20 >pfam02009 Rifin_STEVOR Rifin/stevor family. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens. Probab=28.47 E-value=40 Score=14.02 Aligned_cols=14 Identities=29% Similarity=0.465 Sum_probs=8.6 Q ss_pred HHHHHHHHHHCCCC Q ss_conf 99999999420379 Q gi|255764466|r 161 FITSIAMLKISRKK 174 (174) Q Consensus 161 ~i~~~~~~~~~kkk 174 (174) .+-++.++|++||| T Consensus 262 MvIIYLILRYRRKK 275 (289) T pfam02009 262 MLIIYLILRYRRKK 275 (289) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999873212 No 21 >KOG1018 consensus Probab=28.24 E-value=20 Score=15.86 Aligned_cols=10 Identities=30% Similarity=0.883 Sum_probs=7.2 Q ss_pred HCCCCHHHHH Q ss_conf 2788705579 Q gi|255764466|r 36 GGYPPCDLCI 45 (174) Q Consensus 36 ~gl~PC~LCi 45 (174) --.|||++|- T Consensus 90 vt~ePc~mC~ 99 (169) T KOG1018 90 VTCEPCPMCA 99 (169) T ss_pred EEECCCHHHH T ss_conf 9955448899 No 22 >TIGR02611 TIGR02611 conserved hypothetical protein TIGR02611; InterPro: IPR013434 Proteins in this entry are putative Actinobacterial proteins of about 150 amino acids in length, with three predicted transmembrane helices and an unusual motif with consensus sequence PGPGW.. Probab=28.15 E-value=36 Score=14.32 Aligned_cols=20 Identities=15% Similarity=0.107 Sum_probs=7.1 Q ss_pred HHHCCCHHHHHHHHHHHHHH Q ss_conf 32101468899999999999 Q gi|255764466|r 142 YVLGLSLAFWNIIVSFFLSF 161 (174) Q Consensus 142 ~flGlSma~wn~i~~~~l~~ 161 (174) ++=-++++.--+++-+.++. T Consensus 96 r~R~~~~~~~~v~~~~V~~G 115 (126) T TIGR02611 96 RVRALLVGLLIVVIWAVLAG 115 (126) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999 No 23 >pfam01790 LGT Prolipoprotein diacylglyceryl transferase. Probab=26.57 E-value=43 Score=13.81 Aligned_cols=28 Identities=21% Similarity=0.209 Sum_probs=17.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 2101468899999999999999999942037 Q gi|255764466|r 143 VLGLSLAFWNIIVSFFLSFITSIAMLKISRK 173 (174) Q Consensus 143 flGlSma~wn~i~~~~l~~i~~~~~~~~~kk 173 (174) ..|+|+++| .|+.+.++....+.+.+|| T Consensus 230 ~~~lt~~Q~---~sl~~i~~G~~l~~~~~rr 257 (257) T pfam01790 230 GGGLRMGQI---LSIPMILLGIILIIFARRK 257 (257) T ss_pred CCCCCHHHH---HHHHHHHHHHHHHHHHHCC T ss_conf 288249999---9999999999999987249 No 24 >pfam05879 RHD3 Root hair defective 3 GTP-binding protein (RHD3). This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement. The family also contains the homologous yeast synthetic enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking. Probab=22.01 E-value=53 Score=13.28 Aligned_cols=45 Identities=20% Similarity=0.105 Sum_probs=17.7 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999997201111101225999999999999999998658 Q gi|255764466|r 48 QKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVG 97 (174) Q Consensus 48 R~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g~~ia~yH~g 97 (174) ++|+|+.+++.+++. .......|-=+++..+..+.+.++..|+.+ T Consensus 646 ~iP~w~~~lLlvLGw-----NE~m~VLrnPl~~~ll~v~~~~~y~~~~l~ 690 (741) T pfam05879 646 QIPPYFYVLLLVLGW-----NEFMAVLRNPLYFLLLFVLGLTVYVLYQLG 690 (741) T ss_pred CCCHHHHHHHHHHHH-----HHHHHHHHCHHHHHHHHHHHHHHHHHHHHC T ss_conf 787999999999808-----999999988799999999999999999931 No 25 >PTZ00042 stevor; Provisional Probab=21.89 E-value=53 Score=13.27 Aligned_cols=32 Identities=16% Similarity=0.108 Sum_probs=15.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 321014688999999999999999999420379 Q gi|255764466|r 142 YVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 (174) Q Consensus 142 ~flGlSma~wn~i~~~~l~~i~~~~~~~~~kkk 174 (174) .|..-.+|...+++-.++ ++-++.+++.+||+ T Consensus 261 ~F~P~GIaalVLlilaVv-LIILYIWLyrRRKn 292 (304) T PTZ00042 261 AFYPCGIAALVLLILAVV-LIILYIWLYRRRKN 292 (304) T ss_pred HHCCCHHHHHHHHHHHHH-HHHHHHHHHHHHCC T ss_conf 411629999999999999-99999999984124 No 26 >PRK10332 hypothetical protein; Provisional Probab=21.59 E-value=54 Score=13.23 Aligned_cols=23 Identities=9% Similarity=0.167 Sum_probs=10.3 Q ss_pred HHHHHHHHHCCCCCCCCCCHHHH Q ss_conf 58899998428999847100332 Q gi|255764466|r 121 TVDLLTQMEQENIPSCNKTTLYV 143 (174) Q Consensus 121 ~~~l~~~l~~~~~~~C~ev~w~f 143 (174) +..+-.+-..+....|..++=+. T Consensus 66 p~gWq~~r~qt~~a~C~~itV~v 88 (107) T PRK10332 66 PANWQVNRMQTSQAGCVSISVTL 88 (107) T ss_pred CCCCCHHHEEECCCCEEEEEEEE T ss_conf 98752010150677608999999 No 27 >PTZ00046 rifin; Provisional Probab=20.85 E-value=56 Score=13.14 Aligned_cols=14 Identities=29% Similarity=0.472 Sum_probs=9.0 Q ss_pred HHHHHHHHHHCCCC Q ss_conf 99999999420379 Q gi|255764466|r 161 FITSIAMLKISRKK 174 (174) Q Consensus 161 ~i~~~~~~~~~kkk 174 (174) -+-++..+|++||| T Consensus 321 MvIIYLILRYRRKK 334 (348) T PTZ00046 321 MVIIYLILRYRRKK 334 (348) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999873201 Done!