RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] (174 letters) >gnl|CDD|179370 PRK02110, PRK02110, disulfide bond formation protein B; Provisional. Length = 169 Score = 37.7 bits (88), Expect = 0.002 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 43/170 (25%) Query: 26 IVCF------LMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLST--RNHNSYWSTRLL 77 ++C L +Q+V G PC LCI ++ Y LIA+ A L+ RN W L Sbjct: 20 LICLALVGGALYLQYVKGEDPCPLCIIQR---YAFLLIAIFAFLAAAMRNTRGVWVLEGL 76 Query: 78 LMTLGLLMFFNMTISVIHV------GIECGIWEKNAICMNNSKIESITSTVDLLTQMEQE 131 ++ L + ++ HV G CG I+++ VD L + Sbjct: 77 IVLSALG---GIAVAGRHVYIQLNPGFSCG-------------IDALQPIVDSLPPAKW- 119 Query: 132 NIPSCNK-----TTLY--VLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 +P K T Y +LGLSL W +I +F L + L +R++ Sbjct: 120 -LPGVFKVDGLCETPYPPILGLSLPGWALI-AFVLIAVAVAVSLIRNRRR 167 >gnl|CDD|162585 TIGR01893, aa-his-dipept, aminoacyl-histidine dipeptidase. Length = 477 Score = 28.9 bits (65), Expect = 0.68 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Query: 88 NMTISVIHVGIECGIWEKNAICMNNSKIESIT---STVDLLTQMEQENIPSCNKT 139 + + VIH G+ECGI I I+ I+ + D + E+ +I S K Sbjct: 416 DPEVKVIHAGLECGI-----ISSKIPDIDMISIGPNIYDPHSPNERVSISSVEKV 465 >gnl|CDD|148137 pfam06339, Ectoine_synth, Ectoine synthase. This family consists of several bacterial ectoine synthase proteins. The ectABC genes encode the diaminobutyric acid acetyltransferase (EctA), the diaminobutyric acid aminotransferase (EctB), and the ectoine synthase (EctC). Together these proteins constitute the ectoine biosynthetic pathway. Length = 127 Score = 28.3 bits (64), Expect = 0.96 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 72 W-STRLLLMTLGLLMFFNMTISVIHVGIECGIWEKN 106 W S RLLL G M F+ I+ I+ G E I KN Sbjct: 21 WESRRLLLKDDG--MGFSFHITTIYAGTETHIHYKN 54 >gnl|CDD|184986 PRK15026, PRK15026, aminoacyl-histidine dipeptidase; Provisional. Length = 485 Score = 28.1 bits (62), Expect = 1.1 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Query: 86 FFNMT--ISVIHVGIECGIWEK 105 FN T I +IH G+ECG+++K Sbjct: 418 LFNKTPNIQIIHAGLECGLFKK 439 >gnl|CDD|177545 PHA03150, PHA03150, hypothetical protein; Provisional. Length = 456 Score = 27.9 bits (62), Expect = 1.6 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 102 IWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNK--TTLYVLGLSLAFW 151 IW+ N I + VDLL+ ++++IP+ N T+ G++L W Sbjct: 27 IWQVNLITCGIQHESAFCFVVDLLSNTDRDSIPALNSHQPTIQEHGVNLMQW 78 >gnl|CDD|179331 PRK01749, PRK01749, disulfide bond formation protein B; Provisional. Length = 176 Score = 26.4 bits (59), Expect = 4.4 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 28 CFLMIQHVGGYPPCDLCIQEQKIYYFGFLIA 58 L QHV PC +CI E ++ FG L A Sbjct: 28 TALYFQHVMLLKPCVMCIYE-RVALFGILGA 57 >gnl|CDD|183953 PRK13290, ectC, L-ectoine synthase; Reviewed. Length = 125 Score = 26.0 bits (58), Expect = 5.6 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 72 W-STRLLLMTLGLLMFFNMTISVIHVGIECGIWEKN 106 W S RLLL G M F+ + I+ G E + KN Sbjct: 21 WTSRRLLLKDDG--MGFSFHETTIYAGTETHLHYKN 54 >gnl|CDD|132031 TIGR02986, restrict_Alw26I, type II restriction endonuclease, Alw26I/Eco31I/Esp3I family. Members of this family are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. Characterized specificities of three members are GGTCTC, CGTCTC, and the shared subsequence GTCTC. Length = 424 Score = 25.9 bits (57), Expect = 5.6 Identities = 6/20 (30%), Positives = 8/20 (40%) Query: 34 HVGGYPPCDLCIQEQKIYYF 53 H G PC C + + Y Sbjct: 78 HPTGVKPCQTCGKTMSLGYS 97 >gnl|CDD|118197 pfam09665, RE_Alw26IDE, Type II restriction endonuclease (RE_Alw26IDE). Members of this entry are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. characterized specificities of the three members are GGTCTC, CGTCTC and the shared subsequence GTCTC. Length = 511 Score = 25.5 bits (56), Expect = 6.6 Identities = 6/20 (30%), Positives = 8/20 (40%) Query: 34 HVGGYPPCDLCIQEQKIYYF 53 H G PC C + + Y Sbjct: 78 HPTGVKPCKTCGKTMSLGYS 97 >gnl|CDD|161757 TIGR00195, exoDNase_III, exodeoxyribonuclease III. The model brings in reverse transcriptases at scores below 50, model also contains eukaryotic apurinic/apyrimidinic endonucleases which group in the same family. Length = 254 Score = 25.8 bits (57), Expect = 6.9 Identities = 12/59 (20%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Query: 16 RIILLNISGVIVCF-LMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWS 73 +II N++G+ + + P LC+QE K+ F + ++ ++S Sbjct: 2 KIISWNVNGLRARLHKGLAWLKENQPDVLCLQETKVQDEQFPLEPFHKE---GYHVFFS 57 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.329 0.141 0.427 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,665,567 Number of extensions: 153591 Number of successful extensions: 499 Number of sequences better than 10.0: 1 Number of HSP's gapped: 498 Number of HSP's successfully gapped: 28 Length of query: 174 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 87 Effective length of database: 4,114,577 Effective search space: 357968199 Effective search space used: 357968199 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 54 (24.5 bits)