RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] (174 letters) >2zuq_A Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* (A:) Length = 176 Score = 73.5 bits (180), Expect = 2e-14 Identities = 24/174 (13%), Positives = 50/174 (28%), Gaps = 10/174 (5%) Query: 5 LLSTLANIPLPRIILLNISGVIVCFLMI----QHVGGYPPCDLCIQEQKIYYFGFLIALV 60 +L L R L ++ + + QHV P LCI E+ + AL+ Sbjct: 1 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALI 60 Query: 61 ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120 + + ++ F + ++ H ++ E Sbjct: 61 GAI----APKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPE--WL 114 Query: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 +D C + LGL + W + + + + ++ K Sbjct: 115 PLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKA 168 >3ddj_A CBS domain-containing protein; NP_344512.1, structural genomics, joint center for structural genomics, JCSG; HET: AMP; 1.80A {Sulfolobus solfataricus} (A:1-103,A:206-232) Length = 130 Score = 29.9 bits (67), Expect = 0.19 Identities = 14/38 (36%), Positives = 22/38 (57%) Query: 108 ICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLG 145 I + N KIE + +T DLL+ +E SC++ LY + Sbjct: 54 IIVANEKIEGLLTTRDLLSTVESYCKDSCSQGDLYHIS 91 >2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} (A:1-245) Length = 245 Score = 28.2 bits (62), Expect = 0.62 Identities = 12/101 (11%), Positives = 23/101 (22%), Gaps = 7/101 (6%) Query: 30 LMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLS--TRNHNSYWSTRLLLMTLGLLMFF 87 L I H+ Q V + + + S R L + + Sbjct: 44 LHIGHLATILTMRRFQQAGHRPIAL-----VGGATGLIGDPSGKKSERTLNAKETVEAWS 98 Query: 88 NMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQM 128 + ++ A NN + L + Sbjct: 99 ARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITFLRDV 139 >1n3k_A Astrocytic phosphoprotein PEA-15; death effector domain, six helix bundle, apoptosis; NMR {Cricetulus griseus} (A:) Length = 130 Score = 25.6 bits (56), Expect = 3.6 Identities = 6/29 (20%), Positives = 11/29 (37%) Query: 113 SKIESITSTVDLLTQMEQENIPSCNKTTL 141 K E IT+ + +E N + + Sbjct: 34 EKSEEITTGSAWFSFLESHNKLDKDNLSY 62 >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A (A:16-148,A:348-434) Length = 220 Score = 25.6 bits (56), Expect = 3.9 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 13 PLPRIILLNISGVIVCFLMIQHVGGYP 39 P P ++LL+ GV+ F MI G Sbjct: 171 PAPVLMLLSTDGVLCPFYMINQNPGVK 197 >2do9_A NALP10, nacht-, LRR- and PYD-containing protein 10; apoptosis, inflammation, structural genomics, NPPSFA; NMR {Mus musculus} (A:) Length = 115 Score = 24.3 bits (53), Expect = 8.9 Identities = 9/46 (19%), Positives = 17/46 (36%) Query: 1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQ 46 +K L + L R L ++S V + +I G + + Sbjct: 34 TLKFHLRDVTQFHLARGELESLSQVDLASKLISMYGAQEAVRVVSR 79 >1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A (A:202-276,A:338-532) Length = 270 Score = 24.4 bits (53), Expect = 9.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 27 VCFLMIQHVGGYPPCDLCIQEQKIYYF 53 V FL G PP + +EQ YYF Sbjct: 89 VIFLSADAFGVLPPVSILSKEQTKYYF 115 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.329 0.141 0.427 Gapped Lambda K H 0.267 0.0581 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,218,401 Number of extensions: 47278 Number of successful extensions: 117 Number of sequences better than 10.0: 1 Number of HSP's gapped: 116 Number of HSP's successfully gapped: 13 Length of query: 174 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 91 Effective length of database: 2,150,234 Effective search space: 195671294 Effective search space used: 195671294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.7 bits)