Query gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] Match_columns 361 No_of_seqs 128 out of 2077 Neff 9.8 Searched_HMMs 39220 Date Sun May 29 18:15:21 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764468.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam03739 YjgP_YjgQ Predicted 100.0 0 0 372.9 31.2 346 6-356 1-353 (353) 2 COG0795 Predicted permeases [G 100.0 0 0 322.4 30.6 354 1-358 1-362 (364) 3 pfam02687 FtsX Predicted perme 90.9 0.51 1.3E-05 22.9 4.8 52 73-124 70-121 (174) 4 pfam06835 DUF1239 Protein of u 90.3 0.65 1.6E-05 22.4 4.9 46 169-214 70-115 (176) 5 pfam06570 DUF1129 Protein of u 90.0 0.99 2.5E-05 21.3 6.5 31 329-359 172-202 (206) 6 PRK10814 outer membrane-specif 89.7 1.1 2.7E-05 21.2 6.1 16 345-360 374-389 (396) 7 COG4591 LolE ABC-type transpor 89.4 0.99 2.5E-05 21.3 5.3 26 60-85 30-55 (408) 8 pfam02405 DUF140 Domain of unk 86.1 1.8 4.5E-05 19.9 9.4 106 15-121 16-124 (215) 9 TIGR02212 lolCE lipoprotein re 83.1 2.4 6.2E-05 19.1 6.3 10 189-198 153-162 (414) 10 PRK11026 ftsX cell division pr 77.8 3.7 9.5E-05 18.1 6.6 13 346-358 290-302 (309) 11 TIGR03434 ADOP Acidobacterial 70.9 5.7 0.00014 17.1 5.9 26 69-94 379-404 (803) 12 PRK11146 outer membrane-specif 69.2 6.2 0.00016 16.9 8.5 18 344-361 386-403 (412) 13 TIGR00439 ftsX putative protei 66.3 6.7 0.00017 16.7 3.1 68 106-185 33-100 (314) 14 COG5375 Uncharacterized protei 51.6 13 0.00033 15.1 4.2 40 170-209 111-150 (216) 15 TIGR03024 arch_pef_cterm PEF-C 49.1 9.8 0.00025 15.8 1.6 23 57-79 3-25 (28) 16 PRK09699 D-allose transporter 43.5 18 0.00045 14.4 3.5 20 106-125 110-129 (325) 17 TIGR01478 STEVOR variant surfa 42.7 18 0.00046 14.3 5.8 15 343-357 287-301 (315) 18 COG0577 SalY ABC-type antimicr 42.5 18 0.00047 14.3 3.1 14 347-360 396-409 (419) 19 TIGR02614 ftsW cell division p 35.2 24 0.00061 13.6 7.7 19 98-116 69-87 (370) 20 PRK10535 macrolide transporter 32.0 25 0.00065 13.5 1.5 34 61-95 277-310 (648) 21 TIGR00847 ccoS cytochrome oxid 27.4 33 0.00084 12.8 2.0 10 63-72 6-15 (53) 22 PRK11285 araH L-arabinose tran 27.4 33 0.00084 12.8 2.2 20 105-124 112-131 (327) 23 pfam06691 DUF1189 Protein of u 25.6 36 0.00091 12.6 13.1 30 126-155 52-81 (250) 24 pfam05297 Herpes_LMP1 Herpesvi 24.7 37 0.00095 12.5 9.2 38 69-108 112-149 (382) 25 TIGR01517 ATPase-IIB_Ca calciu 24.6 37 0.00095 12.5 1.5 76 12-89 272-351 (885) 26 KOG0653 consensus 24.3 38 0.00096 12.5 2.4 13 267-279 163-175 (391) 27 PHA00442 host recBCD nuclease 21.8 42 0.0011 12.2 2.4 22 77-98 22-44 (59) 28 TIGR00383 corA magnesium and c 20.2 32 0.00081 12.9 0.2 29 303-334 271-299 (339) No 1 >pfam03739 YjgP_YjgQ Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this. Probab=100.00 E-value=0 Score=372.94 Aligned_cols=346 Identities=24% Similarity=0.399 Sum_probs=294.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999985079998999999999747999999999999999999999865568 Q gi|255764468|r 6 LYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTE 85 (361) Q Consensus 6 rYi~k~~l~~f~~~~~~l~~i~~~~~~~~~l~~~~~~~~~~~~~l~~~~l~lP~~l~~~lP~a~li~~l~~~~~L~~~~E 85 (361) ||++|+++++|+++++++++++++.|++++++++.+++.++..+++|+++++|..+.+++|+++++|+++++++|++||| T Consensus 1 RYi~k~~l~~fl~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~lP~~l~~~lP~s~lia~l~~~~~L~~~~E 80 (353) T pfam03739 1 RYILREFLKPFLLVLLVLLLLFLLVDLLRLLDLILGGGLPLADILRLLLLLLPSILELILPLALLLAVLLTLGRLARDSE 80 (353) T ss_pred CEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH T ss_conf 92389999999999999999999999999999997189999999999999889999999999999999999999984264 Q ss_pred HHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCHHHHHHHHHHH Q ss_conf 89998735453221242100004665553101210127887765444556542000112220121012203434534442 Q gi|255764468|r 86 LLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYN 165 (361) Q Consensus 86 l~al~a~GiS~~~i~~p~l~~~~~i~~~~~~l~~~i~P~~~~~~~~~~~~~~~~~~~~~~~~g~f~~~~~~~~i~i~~~~ 165 (361) ++||||+|+|.+|+++|++.++++++++.++++++++|+++++.++..++..++......++|.|.+.++|.++|+++.+ T Consensus 81 l~a~~a~GiS~~~i~~p~l~~~~~~~~~~~~~~~~v~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~~~~ 160 (353) T pfam03739 81 LTALRAAGISLKRLLRPVLILALLLSLLSFLLSEYLVPYANQKLEQLLAEILSKAPSLLLRPGLFLRDGDGLIIYVKKVD 160 (353) T ss_pred HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCHHCCCCCEEEECCCCEEEEEEEEC T ss_conf 89999838990667899999999999999998540306999999999999860662001479806986997799999983 Q ss_pred HHC-CCCCEEEEEECCCCCEEEEEEEEEEEECC--CCEEEEECCEEEEECCCCCCEEEEEECCCCCCCCCCCC--CCCCC Q ss_conf 100-01101355303578515787500257228--95699877878885178862124430122012566563--10014 Q gi|255764468|r 166 PNN-TLQGIFIVDSRDTQTHKIYYAQSGSIDLD--RQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANS--STIVL 240 (361) Q Consensus 166 ~~~-~l~~v~i~~~~~~~~~~~i~A~~~~~~~~--~~~~~l~~g~~~~~~~~~~~~~~~~F~~~~~~~~~~~~--~~~~~ 240 (361) +++ .++||++++.++++...++.|++|+++.+ +..|.|+||++++.++++++.+..+|+++.++....+. ..... T Consensus 161 ~~~~~l~~v~i~~~~~~~~~~~i~A~~a~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~ 240 (353) T pfam03739 161 PDGRLLEGVFIYDFRDGGLTSVITAKSATLDSDPNGGVWILENGTIYRFDKDGEELSILSFDRYEIDLSLTPKDLSSLTA 240 (353) T ss_pred CCCCEEEEEEEEEECCCCCEEEEEECEEEEEECCCCCEEEEECCEEEEECCCCCCEEEEEEEEEEEECCCCHHHHHHHCC T ss_conf 89986865899980699835999968189986599977999755999954899725777611378544688777644128 Q ss_pred CCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 60028989986200433541368989999999999999999999999999986245555653015899999999999999 Q gi|255764468|r 241 KANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFW 320 (361) Q Consensus 241 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~el~~rls~pl~~l~~~lla~~~~~~~~~~r~~~~~~~~~~~l~~~~~~~~ 320 (361) ++++++.++|.... +.....+.+..+++.|+|+|++.|++|++++++|++++...+ | ++....++.++++++. |+ T Consensus 241 ~~~~ls~~~L~~~i-~~~~~~~~~~~~~~~~~~~r~~~pl~~l~l~ll~~~l~~~~~--R-~~~~~~~~~~l~~~~~-y~ 315 (353) T pfam03739 241 DPEELSLSELYAYI-KRLKASGLDVRKYRAELHRRLALPLSCLVLALLALPLGLGSP--R-SGRGAGLVLAILLGFL-YY 315 (353) T ss_pred CHHHHHHHHHHHHH-HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--C-CCCHHHHHHHHHHHHH-HH T ss_conf 87887789999999-999866776114699999999989999999999999831676--6-7726999999999999-99 Q ss_pred HHHHHHHHHCCCCHHHHHH--HHHHHHHHHHHHHHHHH Q ss_conf 9999999721342278999--99999999999999960 Q gi|255764468|r 321 GFSYIIHKIEQNPYYIPIL--YLFLFCISSIFLLMIKK 356 (361) Q Consensus 321 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 356 (361) .........+.++.++|++ |.+.+.+..++.++++| T Consensus 316 ~l~~~~~~l~~~~~i~p~~a~w~p~~i~~~i~~~l~~r 353 (353) T pfam03739 316 VLLFLGEALGENGVLPPLLAAWLPNLLFLLLGLYLLLR 353 (353) T ss_pred HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCC T ss_conf 99999999997499019999999999999999999709 No 2 >COG0795 Predicted permeases [General function prediction only] Probab=100.00 E-value=0 Score=322.35 Aligned_cols=354 Identities=23% Similarity=0.310 Sum_probs=265.3 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 935689999999999999999999999999999999-9985079998999999999747999999999999999999999 Q gi|255764468|r 1 MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRI-NLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTS 79 (361) Q Consensus 1 M~il~rYi~k~~l~~f~~~~~~l~~i~~~~~~~~~l-~~~~~~~~~~~~~l~~~~l~lP~~l~~~lP~a~li~~l~~~~~ 79 (361) |++++||+.|+++++|+.+++++++++++.++++.+ +...+++++..+++.++.+++|..+.+++|+++++|+++++++ T Consensus 1 m~~l~rYl~r~~l~~~l~~ll~l~~i~~~~~~~~~~~~~~~~g~~~~~~~~~l~~l~iP~~l~~~lP~a~lia~l~~l~~ 80 (364) T COG0795 1 MMLLDRYLLREYLKTFLAILLVLLAILLIIDLLELLNGKAVDGRYPALDVLLLLLLSLPTLLPLVLPLALLIAALLTLGR 80 (364) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 90899999999999999999999999999999999998872378799999999999878999999889999999999999 Q ss_pred HHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCHHH-H Q ss_conf 865568899987354532212421000046655531012101278877654445565420001122201210122034-3 Q gi|255764468|r 80 MNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDL-Y 158 (361) Q Consensus 80 L~~~~El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~l~~~i~P~~~~~~~~~~~~~~~~~~~~~~~~g~f~~~~~~~-~ 158 (361) |+++||+++|+|+|+|.+|+++|++..+++++++.+++++++.|+++++.++..++..++......+++.++...++. . T Consensus 81 L~~~sEl~vl~A~GvS~~~li~p~l~~al~~~~l~~~~~~~l~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (364) T COG0795 81 LSRESELVVLRASGVSLKRLLRPVLILALLLSLLSFVLGLWLAPWAEQKARELLAQAKAGGPSLGSVEGGFWAKDGNDSL 160 (364) T ss_pred HHHCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEE T ss_conf 75037199998828988999999999999999999998384387799999999999844886411125651203798428 Q ss_pred HHHHHHHHH-CCCCCEEEEEECCCCCEEEEEEEEEEE-ECCCCEEEEE--CCEEEEECCCCCCEEEEEECCCCCCCCCCC Q ss_conf 453444210-001101355303578515787500257-2289569987--787888517886212443012201256656 Q gi|255764468|r 159 IKISKYNPN-NTLQGIFIVDSRDTQTHKIYYAQSGSI-DLDRQAIILN--DGEVHRKSPISKDISIMKFKSYTLQTESAN 234 (361) Q Consensus 159 i~i~~~~~~-~~l~~v~i~~~~~~~~~~~i~A~~~~~-~~~~~~~~l~--~g~~~~~~~~~~~~~~~~F~~~~~~~~~~~ 234 (361) +++++.+++ +.+.++++++.++++....++++++.. +.++..|.++ ++..+............+|+.+..+..... T Consensus 161 ~~~~~~~~~~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~ 240 (364) T COG0795 161 IFIESIDRDGNKLQGVFIKRFDDNGRLSVVYAAEGALFELEDGSWILELVDGTRYEGTPKEGDSRIVDFDWYTLLLPDLL 240 (364) T ss_pred EEEEEECCCCCEECCEEEEEECCCCCCCEEEHHCCCCCCCCCCEEEEEECCCEEECCCCCCCCCCCCCCHHHCCCCCHHH T ss_conf 99988627876451578981257777413441003200168971688705540443656556635234423214673333 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH Q ss_conf 31001460028989986200433541368989999999999999999999999999986245555653015899999999 Q gi|255764468|r 235 SSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSI 314 (361) Q Consensus 235 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~el~~rls~pl~~l~~~lla~~~~~~~~~~r~~~~~~~~~~~l~~ 314 (361) .......+++.+..++....... ...+++...|..|+|+|++.|++|++|+++|++++...++ .+.....+..++.+ T Consensus 241 ~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~el~~r~a~pl~~~~~~lla~~l~~~~~R--~~~~~~~~~~~i~~ 317 (364) T COG0795 241 IREALLSPKALSLSELPTYILLN-KDNGQDRKTLLAELYRRLALPLLVLAMALLALPLSLRNPR--SGRLGLRLLGGILL 317 (364) T ss_pred HHHHHCCCCCCCHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCCHHHHHHHHHHH T ss_conf 21143077421067776677540-3254014799999999999999999999999998512554--53439999999999 Q ss_pred HHHHHHHHHHHHHHHCCCCHHHH--HHHHHHHHHHHHHHHHHHHCC Q ss_conf 99999999999997213422789--999999999999999996012 Q gi|255764468|r 315 SFGVFWGFSYIIHKIEQNPYYIP--ILYLFLFCISSIFLLMIKKKY 358 (361) Q Consensus 315 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~ 358 (361) ++. |+.........+.++.++| .+|.+.+....++.++.+++- T Consensus 318 ~~~-~~~~~~~~~~~~~~~~l~p~~a~~~p~~v~l~~~~~l~~~~~ 362 (364) T COG0795 318 GLL-FYVLLFLLGALALAGKLPPFLAAWLPNLVFLALGLWLLRRKE 362 (364) T ss_pred HHH-HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999-999999999999737822799999999999999999998510 No 3 >pfam02687 FtsX Predicted permease. This is a family of predicted permeases and hypothetical transmembrane proteins. The lipoprotein-releasing system transmembrane protein lolC from Buchnera aphidicola has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both lolC and an ATP-binding cassette transporter-like protein from Streptococcus cristatus have been shown to require ATP. Probab=90.88 E-value=0.51 Score=22.95 Aligned_cols=52 Identities=19% Similarity=0.233 Sum_probs=33.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHH Q ss_conf 9999999865568899987354532212421000046655531012101278 Q gi|255764468|r 73 TTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPK 124 (361) Q Consensus 73 ~l~~~~~L~~~~El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~l~~~i~P~ 124 (361) ..+...-..|..|+-.+|+.|.+.+++.+.++.-+++++++...++..+.-. T Consensus 70 ~~~~~~i~~r~~ei~ilka~G~~~~~i~~~~~~e~~~~~~~~~~~g~~~~~~ 121 (174) T pfam02687 70 NLLSISIAERRREIGILKALGASKKQIFKLLLLEALLLGLIGSLLGLLLGFL 121 (174) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999299999999999999999999999999999999 No 4 >pfam06835 DUF1239 Protein of unknown function (DUF1239). This family consists of several hypothetical bacterial proteins of around 190 residues in length. The function of this family is unknown. Probab=90.27 E-value=0.65 Score=22.37 Aligned_cols=46 Identities=13% Similarity=0.091 Sum_probs=29.1 Q ss_pred CCCCEEEEEECCCCCEEEEEEEEEEEECCCCEEEEECCEEEEECCC Q ss_conf 0110135530357851578750025722895699877878885178 Q gi|255764468|r 169 TLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPI 214 (361) Q Consensus 169 ~l~~v~i~~~~~~~~~~~i~A~~~~~~~~~~~~~l~~g~~~~~~~~ 214 (361) .+.+..+....+++..-.+.|++|.+..++..+.|.+...-....+ T Consensus 70 ~l~~P~~~~~~~~~~~w~i~A~~g~~~~~~~~i~L~g~V~i~~~~~ 115 (176) T pfam06835 70 EFTNPVLIIYQDGKPPWTITADRAKLNKDGQTLYLYGNVVIQSLED 115 (176) T ss_pred EEEEEEEEEECCCCCEEEEEECEEEEECCCCEEEEECCEEEEECCC T ss_conf 9996399997799836999979499937996999989999997689 No 5 >pfam06570 DUF1129 Protein of unknown function (DUF1129). This family consists of several hypothetical bacterial proteins of unknown function. Probab=89.99 E-value=0.99 Score=21.33 Aligned_cols=31 Identities=29% Similarity=0.375 Sum_probs=24.4 Q ss_pred HCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 2134227899999999999999999960124 Q gi|255764468|r 329 IEQNPYYIPILYLFLFCISSIFLLMIKKKYT 359 (361) Q Consensus 329 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 359 (361) ...||.++|++.+.+-+++...-+++||||. T Consensus 172 ~~INP~Lp~~v~iiigaia~~~r~~lkkky~ 202 (206) T pfam06570 172 PVINPVLPPWVYIIIGAIAFGVRYYLKKKYN 202 (206) T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 2258898669999999999999999999727 No 6 >PRK10814 outer membrane-specific lipoprotein transporter subunit LolC; Provisional Probab=89.69 E-value=1.1 Score=21.19 Aligned_cols=16 Identities=13% Similarity=0.017 Sum_probs=6.6 Q ss_pred HHHHHHHHHHHHCCCC Q ss_conf 9999999999601247 Q gi|255764468|r 345 CISSIFLLMIKKKYTK 360 (361) Q Consensus 345 ~~~~~~~~~~~~~~~~ 360 (361) .++.++.++-.+|=+| T Consensus 374 ~i~~la~~~PA~~Aa~ 389 (396) T PRK10814 374 AIALLSTLYPSWRAAA 389 (396) T ss_pred HHHHHHHHHHHHHHHC T ss_conf 9999999999999958 No 7 >COG4591 LolE ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Probab=89.44 E-value=0.99 Score=21.32 Aligned_cols=26 Identities=8% Similarity=0.229 Sum_probs=10.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999865568 Q gi|255764468|r 60 VLPMVTPFCFAMETTNVLTSMNRNTE 85 (361) Q Consensus 60 ~l~~~lP~a~li~~l~~~~~L~~~~E 85 (361) .+...+-+++++-++.....+.++-| T Consensus 30 ~~GI~lgV~~LIv~lsvmnGf~~el~ 55 (408) T COG4591 30 LIGIALGVAVLIVVLSVMNGFQKELE 55 (408) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999889999999998856799998 No 8 >pfam02405 DUF140 Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Probab=86.13 E-value=1.8 Score=19.91 Aligned_cols=106 Identities=14% Similarity=0.191 Sum_probs=59.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999985079998999999999--7479999999999999999999998655688999873 Q gi|255764468|r 15 SFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGY--LIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNT 92 (361) Q Consensus 15 ~f~~~~~~l~~i~~~~~~~~~l~~~~~~~~~~~~~l~~~~l--~lP~~l~~~lP~a~li~~l~~~~~L~~~~El~al~a~ 92 (361) +.......+++..+..+...+++++.... -...++..... .-|-....++---.=-+.---+|.|.-+.|+.|+++. T Consensus 16 ~iv~~~~~~~G~v~~~q~~~~l~~~G~~~-~ig~~~~~~~vRElgP~ltalilagR~Gsa~aAElGtM~v~eeIDAL~~m 94 (215) T pfam02405 16 PIVALTAFFIGAVLALQGAYQLRQFGAES-FVGALVALSLVRELGPVLTALLVAGRVGSAITAELGTMRVTEEIDALEVM 94 (215) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999849189-99999999999999899999999998713999999872698899999984 Q ss_pred CCCCCCCC-CCCCCCCHHHHHHHHCCCCCH Q ss_conf 54532212-421000046655531012101 Q gi|255764468|r 93 GTSRITLI-KPVLFLAILLSIFLFISENII 121 (361) Q Consensus 93 GiS~~~i~-~p~l~~~~~i~~~~~~l~~~i 121 (361) |+++.+.+ .|=++.+++...........+ T Consensus 95 gi~P~~yLv~PRvlA~~i~~p~L~i~~~~~ 124 (215) T pfam02405 95 GIDPIRYLVLPRVLAGVIALPLLTIIADLV 124 (215) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 899247765989999999999999999999 No 9 >TIGR02212 lolCE lipoprotein releasing system, transmembrane protein, LolC/E family; InterPro: IPR011925 This entry describes the LolC protein, and its paralog LolE found in some species. These proteins are homologous to permease proteins of ABC transporters. In some species, two paralogs occur, designated LolC and LolE. In others, a single form is found and tends to be designated LolC .; GO: 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=83.13 E-value=2.4 Score=19.14 Aligned_cols=10 Identities=10% Similarity=0.182 Sum_probs=3.1 Q ss_pred EEEEEEECCC Q ss_conf 5002572289 Q gi|255764468|r 189 AQSGSIDLDR 198 (361) Q Consensus 189 A~~~~~~~~~ 198 (361) |++=..+.+| T Consensus 153 A~~LgV~~GD 162 (414) T TIGR02212 153 AEKLGVSVGD 162 (414) T ss_pred HHHCCCCCCC T ss_conf 9845899897 No 10 >PRK11026 ftsX cell division protein FtsX; Provisional Probab=77.83 E-value=3.7 Score=18.11 Aligned_cols=13 Identities=15% Similarity=0.018 Sum_probs=5.2 Q ss_pred HHHHHHHHHHHCC Q ss_conf 9999999996012 Q gi|255764468|r 346 ISSIFLLMIKKKY 358 (361) Q Consensus 346 ~~~~~~~~~~~~~ 358 (361) ++.++-|.--+|| T Consensus 290 lG~lgS~~sv~r~ 302 (309) T PRK11026 290 IGWIAAWLATVQH 302 (309) T ss_pred HHHHHHHHHHHHH T ss_conf 9999999999999 No 11 >TIGR03434 ADOP Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown. Probab=70.91 E-value=5.7 Score=17.10 Aligned_cols=26 Identities=8% Similarity=-0.087 Sum_probs=16.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 99999999999865568899987354 Q gi|255764468|r 69 FAMETTNVLTSMNRNTELLIIDNTGT 94 (361) Q Consensus 69 ~li~~l~~~~~L~~~~El~al~a~Gi 94 (361) .+++.++---++++-+=.-++|.++- T Consensus 379 ~llag~~PA~~~s~~~p~~~Lk~~~~ 404 (803) T TIGR03434 379 GLLFGLAPALQATRSDLAEALKEGGR 404 (803) T ss_pred HHHHHHHHHHHHCCCCHHHHHHHCCC T ss_conf 99999999999816788999875266 No 12 >PRK11146 outer membrane-specific lipoprotein transporter subunit LolE; Provisional Probab=69.17 E-value=6.2 Score=16.89 Aligned_cols=18 Identities=11% Similarity=0.161 Sum_probs=8.1 Q ss_pred HHHHHHHHHHHHHCCCCC Q ss_conf 999999999996012479 Q gi|255764468|r 344 FCISSIFLLMIKKKYTKI 361 (361) Q Consensus 344 ~~~~~~~~~~~~~~~~~~ 361 (361) ++++.++.++-.+|=+|+ T Consensus 386 ~i~~~las~~PA~rAa~l 403 (412) T PRK11146 386 LLLSLLASWYPARRASKL 403 (412) T ss_pred HHHHHHHHHHHHHHHHCC T ss_conf 999999999999999787 No 13 >TIGR00439 ftsX putative protein insertion permease FtsX; InterPro: IPR004513 FtsX is an integral membrane protein encoded in the same operon as signal recognition particle docking protein FtsY and FtsE. FtsE is a hydrophilic nucleotide-binding protein that associates with the inner membrane by means of association with FtsX; FtsE mutants are viable only in high salt, supporting possible roles in cell division, as previously indicated, or in transport.; GO: 0007049 cell cycle, 0016021 integral to membrane. Probab=66.29 E-value=6.7 Score=16.70 Aligned_cols=68 Identities=10% Similarity=0.108 Sum_probs=34.9 Q ss_pred CCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCEE Q ss_conf 00466555310121012788776544455654200011222012101220343453444210001101355303578515 Q gi|255764468|r 106 LAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHK 185 (361) Q Consensus 106 ~~~~i~~~~~~l~~~i~P~~~~~~~~~~~~~~~~~~~~~~~~g~f~~~~~~~~i~i~~~~~~~~l~~v~i~~~~~~~~~~ 185 (361) +|.+++++...++..+--.++-..+....- . ++| .+++..|+|.++.-++..-..|.-.-+++++.+. T Consensus 33 FgTlLT~~viAvslTlP~v~Yl~~kn~~~a-~----------t~~-ypspqiTvYl~k~l~~~~a~~Vv~~l~~~kgve~ 100 (314) T TIGR00439 33 FGTLLTVLVIAVSLTLPLVSYLVYKNVQSA-L----------TQL-YPSPQITVYLEKALAEEDADTVVSKLRRDKGVEK 100 (314) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H----------HHC-CCCCCHHHHHHHHHCHHHHHHHHHHHHHHCCCCH T ss_conf 347999999999986579999998857777-4----------201-7884035787750134468999999987406202 No 14 >COG5375 Uncharacterized protein conserved in bacteria [Function unknown] Probab=51.59 E-value=13 Score=15.08 Aligned_cols=40 Identities=25% Similarity=0.267 Sum_probs=27.5 Q ss_pred CCCEEEEEECCCCCEEEEEEEEEEEECCCCEEEEECCEEE Q ss_conf 1101355303578515787500257228956998778788 Q gi|255764468|r 170 LQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVH 209 (361) Q Consensus 170 l~~v~i~~~~~~~~~~~i~A~~~~~~~~~~~~~l~~g~~~ 209 (361) ++.+-....-++....+++|++|-++.+++.+.|++-... T Consensus 111 Le~i~a~~pvg~~~~a~v~Ak~Gvyd~~~ntL~l~~dv~i 150 (216) T COG5375 111 LEGILAILPVGEDNPAQVTAKSGVYDRDTNTLDLTDDVKI 150 (216) T ss_pred EEEEEEECCCCCCCCEEEEECCCEEECCCCEEECCCCEEE T ss_conf 9600155247999734687123426667871324687688 No 15 >TIGR03024 arch_pef_cterm PEF-C-terminal archaeal protein sorting domain. This domain, distantly related to the PEP-Cterm domain described in model TIGR02595, is found in Methanosarcina mazei in four different proteins, as well as in other archaea such as Methanococcoides burtonii. Several proteins with this domain have their genes only a short distance from a distant homology of EpsH, a proposed integral membrane transpeptidase. Probab=49.08 E-value=9.8 Score=15.77 Aligned_cols=23 Identities=13% Similarity=0.202 Sum_probs=15.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 47999999999999999999999 Q gi|255764468|r 57 IPTVLPMVTPFCFAMETTNVLTS 79 (361) Q Consensus 57 lP~~l~~~lP~a~li~~l~~~~~ 79 (361) +|++=...+|++..+|.++.++| T Consensus 3 iPEFPTvAlPv~ailGl~f~f~r 25 (28) T TIGR03024 3 IPEFPTVALPVAAILGLMFFFQR 25 (28) T ss_pred CCCCCHHHHHHHHHHHHHHHHHH T ss_conf 87675258799999999999731 No 16 >PRK09699 D-allose transporter subunit; Provisional Probab=43.51 E-value=18 Score=14.35 Aligned_cols=20 Identities=10% Similarity=-0.147 Sum_probs=8.4 Q ss_pred CCHHHHHHHHCCCCCHHHHH Q ss_conf 00466555310121012788 Q gi|255764468|r 106 LAILLSIFLFISENIIEPKC 125 (361) Q Consensus 106 ~~~~i~~~~~~l~~~i~P~~ 125 (361) .++++..+.-.++.+++-+. T Consensus 110 ~~l~~g~~iG~iNG~lv~~~ 129 (325) T PRK09699 110 GGVLVGGALGAINGCLVNWT 129 (325) T ss_pred HHHHHHHHHHHHHHHHHHHC T ss_conf 99999999999985977750 No 17 >TIGR01478 STEVOR variant surface antigen, stevor family; InterPro: IPR006374 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see . This entry represents the stevor (short for "subtelomeric variable open reading frame") family of predicted variant surface antigens. This is the third largest variant surface antigen family in P. falciparum, with 33 genes identified in the genome of this parasite . The function of these proteins is not known, but they are expressed during several stages of the parasite life-cycle and may play a variety of roles in parasite survival and infection .. Probab=42.71 E-value=18 Score=14.28 Aligned_cols=15 Identities=0% Similarity=0.406 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHHHC Q ss_conf 999999999999601 Q gi|255764468|r 343 LFCISSIFLLMIKKK 357 (361) Q Consensus 343 ~~~~~~~~~~~~~~~ 357 (361) .++++.+++|+.||| T Consensus 287 ~V~LIiLYIWLYrRR 301 (315) T TIGR01478 287 TVVLIILYIWLYRRR 301 (315) T ss_pred HHHHHHHHHHHHHHC T ss_conf 999999988885640 No 18 >COG0577 SalY ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Probab=42.52 E-value=18 Score=14.26 Aligned_cols=14 Identities=29% Similarity=0.192 Sum_probs=4.9 Q ss_pred HHHHHHHHHHCCCC Q ss_conf 99999999601247 Q gi|255764468|r 347 SSIFLLMIKKKYTK 360 (361) Q Consensus 347 ~~~~~~~~~~~~~~ 360 (361) +.++.++..++.+| T Consensus 396 ~~i~~~~pa~~~~k 409 (419) T COG0577 396 GVIAGLLPARKAAK 409 (419) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999987 No 19 >TIGR02614 ftsW cell division protein FtsW; InterPro: IPR013437 FtsW is an integral membrane protein with ten transmembrane segments . In general, it is one of two paralogs involved in peptidoglycan biosynthesis, the other being RodA, and is essential for cell division. The FtsW designation is not used in endospore-forming bacteria (e.g. Bacillus subtilis), where these proteins are designated SpoVE, and three or more RodA/FtsW/SpoVE family paralogs are present. SpoVE acts in spore cortex formation and is dispensable for growth. Biological roles for FtsW in cell division include recruitment of penicillin-binding protein 3 to the division site.; GO: 0009252 peptidoglycan biosynthetic process, 0051301 cell division, 0016021 integral to membrane. Probab=35.23 E-value=24 Score=13.60 Aligned_cols=19 Identities=37% Similarity=0.733 Sum_probs=11.1 Q ss_pred CCCCCCCCCCHHHHHHHHC Q ss_conf 2124210000466555310 Q gi|255764468|r 98 TLIKPVLFLAILLSIFLFI 116 (361) Q Consensus 98 ~i~~p~l~~~~~i~~~~~~ 116 (361) |...+++.+++++.++.++ T Consensus 69 ~~~~~~l~~~~~LL~lVli 87 (370) T TIGR02614 69 KLSVPLLLIAIVLLVLVLI 87 (370) T ss_pred HHHHHHHHHHHHHHHHHCC T ss_conf 9999999999999999633 No 20 >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Probab=31.97 E-value=25 Score=13.47 Aligned_cols=34 Identities=18% Similarity=0.210 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 99999999999999999998655688999873545 Q gi|255764468|r 61 LPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTS 95 (361) Q Consensus 61 l~~~lP~a~li~~l~~~~~L~~~~El~al~a~GiS 95 (361) +..++-++.++ +++++|.=.+++-.--+.+.|-. T Consensus 277 LGI~IGI~sVi-~~~slg~G~~~~i~~~~~~lg~n 310 (648) T PRK10535 277 LGIIIGIASVV-SIVVVGDAAKQMVLADIRAIGTN 310 (648) T ss_pred HHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCCC T ss_conf 99999999999-99999889999999999860887 No 21 >TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type; InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation . Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. . Probab=27.43 E-value=33 Score=12.84 Aligned_cols=10 Identities=10% Similarity=0.507 Sum_probs=3.3 Q ss_pred HHHHHHHHHH Q ss_conf 9999999999 Q gi|255764468|r 63 MVTPFCFAME 72 (361) Q Consensus 63 ~~lP~a~li~ 72 (361) +++|+|+++| T Consensus 6 ~L~Pisl~lG 15 (53) T TIGR00847 6 ILIPISLLLG 15 (53) T ss_pred HHHHHHHHHH T ss_conf 7889999999 No 22 >PRK11285 araH L-arabinose transporter permease protein; Provisional Probab=27.36 E-value=33 Score=12.83 Aligned_cols=20 Identities=5% Similarity=0.069 Sum_probs=8.2 Q ss_pred CCCHHHHHHHHCCCCCHHHH Q ss_conf 00046655531012101278 Q gi|255764468|r 105 FLAILLSIFLFISENIIEPK 124 (361) Q Consensus 105 ~~~~~i~~~~~~l~~~i~P~ 124 (361) ..++++..+.-.++.+++.+ T Consensus 112 ~~~l~~G~~~G~iNG~lv~~ 131 (327) T PRK11285 112 AAGLLAGAAVGLVNGFVIAR 131 (327) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999998386761 No 23 >pfam06691 DUF1189 Protein of unknown function (DUF1189). This family consists of several hypothetical bacterial proteins of around 260 residues in length. The function of this family is unknown. Probab=25.55 E-value=36 Score=12.64 Aligned_cols=30 Identities=3% Similarity=0.010 Sum_probs=18.8 Q ss_pred HHHHHHHHHHHHHHCCCCCCCCHHHHCCCH Q ss_conf 776544455654200011222012101220 Q gi|255764468|r 126 RSTIKQLSAKAQLALTFSYLEENLFFRLDD 155 (361) Q Consensus 126 ~~~~~~~~~~~~~~~~~~~~~~g~f~~~~~ 155 (361) ++..+...+...++.|.--+++|.....++ T Consensus 52 ~~~~~~~~~~i~~diP~F~I~nG~L~td~~ 81 (250) T pfam06691 52 QNAMTSFKSALEKDIPDFSIENGELQTDAS 81 (250) T ss_pred HHHHHHHHHHHHHCCCCEEEECCEEEECCC T ss_conf 999998888887309972888795873588 No 24 >pfam05297 Herpes_LMP1 Herpesvirus latent membrane protein 1 (LMP1). This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus. LMP1 of EBV is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N-terminus and a long cytoplasmic carboxy tail of 200 amino acids. EBV latent membrane protein 1 (LMP1) is essential for EBV-mediated transformation and has been associated with several cases of malignancies. EBV-like viruses in Cynomolgus monkeys (Macaca fascicularis) have been associated with high lymphoma rates in immunosuppressed monkeys. Probab=24.69 E-value=37 Score=12.55 Aligned_cols=38 Identities=21% Similarity=0.108 Sum_probs=23.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH Q ss_conf 9999999999986556889998735453221242100004 Q gi|255764468|r 69 FAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAI 108 (361) Q Consensus 69 ~li~~l~~~~~L~~~~El~al~a~GiS~~~i~~p~l~~~~ 108 (361) +.++++++++-..---| .+|-.|.|+|.++...+.+-+ T Consensus 112 ~i~~~LLaL~vW~Ylm~--lL~~~GAs~WtlLAF~LAFlL 149 (382) T pfam05297 112 FIFGCLLVLGLWIYLLE--ILWRLGATIWQLLAFFLAFFL 149 (382) T ss_pred HHHHHHHHHHHHHHHHH--HHHHHCHHHHHHHHHHHHHHH T ss_conf 99999999999999999--999966389999999999999 No 25 >TIGR01517 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA-type; InterPro: IPR006408 This family describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes . In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects . The calcium P-type ATPases have been characterised as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump .; GO: 0005388 calcium-transporting ATPase activity, 0005509 calcium ion binding, 0005524 ATP binding, 0015085 calcium ion transmembrane transporter activity, 0006816 calcium ion transport, 0016020 membrane. Probab=24.62 E-value=37 Score=12.54 Aligned_cols=76 Identities=13% Similarity=0.289 Sum_probs=36.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999998507-999899999999974---799999999999999999999986556889 Q gi|255764468|r 12 IGRSFLMSCLFIVFIAWVIQILQRINLVSSS-TESLNILLKISGYLI---PTVLPMVTPFCFAMETTNVLTSMNRNTELL 87 (361) Q Consensus 12 ~l~~f~~~~~~l~~i~~~~~~~~~l~~~~~~-~~~~~~~l~~~~l~l---P~~l~~~lP~a~li~~l~~~~~L~~~~El~ 87 (361) .+..|.+..+++++++++..++ ++.+..+ ......++.+.+.-+ ==-..+.+|+|+=+|..+..-||.+||-++ T Consensus 272 ~Ig~~G~g~A~l~f~~L~~~~v--~~~~~~~~~~~~~~f~~~Fi~~vTi~VVAVPEGLPLAVT~aLAy~~kkm~~DnNLV 349 (885) T TIGR01517 272 LIGKFGLGSAVLLFLVLVLRYV--IEIIVEDTEEDAQTFLDLFIIAVTIVVVAVPEGLPLAVTLALAYSMKKMMKDNNLV 349 (885) T ss_pred HHHHHHHHHHHHHHHHHHHHHH--HHHHCCCCHHHHHHHHHEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCC T ss_conf 8878999999999999999878--65314898889999864025778999997179862899999998645651012000 Q ss_pred HH Q ss_conf 99 Q gi|255764468|r 88 II 89 (361) Q Consensus 88 al 89 (361) =- T Consensus 350 R~ 351 (885) T TIGR01517 350 RH 351 (885) T ss_pred CC T ss_conf 00 No 26 >KOG0653 consensus Probab=24.31 E-value=38 Score=12.51 Aligned_cols=13 Identities=15% Similarity=0.271 Sum_probs=7.2 Q ss_pred HHHHHHHHHHHHH Q ss_conf 9999999999999 Q gi|255764468|r 267 TYRSEFHKRLTQW 279 (361) Q Consensus 267 ~~~~el~~rls~p 279 (361) .+..|.|.++-.. T Consensus 163 dwlvevh~~F~L~ 175 (391) T KOG0653 163 DWLVEVHEKFGLS 175 (391) T ss_pred HHHHHHHHHCCCC T ss_conf 9999999861997 No 27 >PHA00442 host recBCD nuclease inhibitor Probab=21.78 E-value=42 Score=12.22 Aligned_cols=22 Identities=14% Similarity=0.359 Sum_probs=13.2 Q ss_pred HHHHHHHHHH-HHHHHHCCCCCC Q ss_conf 9998655688-999873545322 Q gi|255764468|r 77 LTSMNRNTEL-LIIDNTGTSRIT 98 (361) Q Consensus 77 ~~~L~~~~El-~al~a~GiS~~~ 98 (361) +..|-+++|. -|+||||+-.|. T Consensus 22 I~sLEkd~efL~al~acgvdnwd 44 (59) T PHA00442 22 IDSLEKENEFLKALKACGVDNWD 44 (59) T ss_pred HHHHHHHHHHHHHHHHCCCCCHH T ss_conf 99999658999999972876514 No 28 >TIGR00383 corA magnesium and cobalt transport protein CorA; InterPro: IPR004488 The CorA transport system is the primary Mg2+ influx system of Salmonella typhimurium and Escherichia coli. It has an unusual membrane topology, with a large, soluble, highly charged periplasmic N-terminal domain with three transmembrane segments in a shorter, hydrophobic C-terminal domain. It has been suggested that the CorA Mg2+ transport system forms the major Mg2+ uptake system in the bacteria and archaea but that some family members may have a function other than Mg2+ transport .; GO: 0015087 cobalt ion transmembrane transporter activity, 0015095 magnesium ion transmembrane transporter activity, 0006824 cobalt ion transport, 0015693 magnesium ion transport, 0016020 membrane. Probab=20.20 E-value=32 Score=12.92 Aligned_cols=29 Identities=21% Similarity=0.258 Sum_probs=13.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH Q ss_conf 01589999999999999999999997213422 Q gi|255764468|r 303 KKIHPIFISLSISFGVFWGFSYIIHKIEQNPY 334 (361) Q Consensus 303 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~ 334 (361) +....++.++.. ++.-.++.++..|.|-. T Consensus 271 N~ImK~lTvvs~---iFiPlTfIAg~YGMNF~ 299 (339) T TIGR00383 271 NEIMKILTVVST---IFIPLTFIAGIYGMNFK 299 (339) T ss_pred HHHHHHHHHHHH---HHHHHHHHCCCCCCCCC T ss_conf 689999999999---98602452031564688 Done!