RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] (361 letters) >2q9f_A Cytochrome P450 46A1; CYP46A1, monooxygenase, cholesterol metabolic enzyme, oxidoreductase, heme, cholesterol-3- sulphate; HET: HEM C3S; 1.90A {Homo sapiens} PDB: 2q9g_A* (A:58-317,A:373-456) Length = 344 Score = 30.9 bits (68), Expect = 0.24 Identities = 8/40 (20%), Positives = 16/40 (40%) Query: 270 SEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIF 309 S+ ++ L +FG + + +QR+ I F Sbjct: 1 SKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAF 40 >3i57_A Mucus binding protein; beta grAsp fold, cell WALL, peptidoglycan-anchor, protein binding; 1.80A {Lactobacillus reuteri} (A:) Length = 185 Score = 28.6 bits (63), Expect = 1.4 Identities = 10/76 (13%), Positives = 26/76 (34%), Gaps = 2/76 (2%) Query: 180 DTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIV 239 + QT ++ + ++G +D + G+ + S K ++ Y S+ Sbjct: 112 EDQTAQVTFTRNGVLDDVTGIVA--WGKWNEASQSYKALTSPTIAGYAPSEAVVKRSSNS 169 Query: 240 LKANDQNLSFLLNPNP 255 L+ + + Sbjct: 170 DAEQGPTLTVIYTADA 185 >2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} (A:1-41,A:90-125) Length = 77 Score = 28.1 bits (62), Expect = 1.7 Identities = 7/22 (31%), Positives = 10/22 (45%), Gaps = 1/22 (4%) Query: 241 KANDQNLSFLLNPNPNNPNYRP 262 + F+ NP +P YRP Sbjct: 53 ELEPGQFHFIFL-NPRDPTYRP 73 >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomography, contractIle protein/transport protein complex; 24.00A {Gallus gallus} (A:1-67) Length = 67 Score = 27.4 bits (61), Expect = 2.8 Identities = 8/30 (26%), Positives = 10/30 (33%) Query: 224 KSYTLQTESANSSTIVLKANDQNLSFLLNP 253 K L+ E L + L L NP Sbjct: 36 KVLQLRLEEGKDLEYCLDPKTKELPPLRNP 65 >2owl_A Recombination-associated protein RDGC; replication, RECA; 2.40A {Escherichia coli} (A:) Length = 303 Score = 26.2 bits (58), Expect = 6.1 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 136 AQLALTFSYLEENLFFRLDDDLYIKISKY 164 +LAL + ++ + F DD +K K+ Sbjct: 230 TKLALDW---QQRIQFVXCDDGSLKRLKF 255 >2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Aeropyrum pernix} (A:233-338) Length = 106 Score = 26.0 bits (57), Expect = 6.8 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Query: 160 KISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEV 208 K+SK P +F+VDS D KI A + + ++ + Sbjct: 6 KMSKSKPETA---VFVVDSDDDIRRKIRKAYCPAKQVQGNPVLEIARYI 51 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.327 0.141 0.408 Gapped Lambda K H 0.267 0.0361 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,532,453 Number of extensions: 108369 Number of successful extensions: 313 Number of sequences better than 10.0: 1 Number of HSP's gapped: 313 Number of HSP's successfully gapped: 20 Length of query: 361 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 271 Effective length of database: 1,913,599 Effective search space: 518585329 Effective search space used: 518585329 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (26.0 bits)