RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] (361 letters) >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Score = 25.9 bits (55), Expect = 5.2 Identities = 7/37 (18%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 248 SFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVI 284 + +++ + +P+Y P+ L +R + ++L L + Sbjct: 1 AIVVDDSVFSPSYVPKRLP-HREQQLQQLDILLGNWL 36 >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Score = 25.4 bits (54), Expect = 8.2 Identities = 8/61 (13%), Positives = 15/61 (24%) Query: 256 NNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSIS 315 + E L F R + IF ++ A+ R+ + Sbjct: 52 CGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMG 111 Query: 316 F 316 Sbjct: 112 K 112 >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Score = 25.1 bits (54), Expect = 8.7 Identities = 8/36 (22%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Query: 247 LSFLLNPNPNNPNYRPELLETY---RSEFHKRLTQW 279 + L +PNPN+P ++ E + + +W Sbjct: 109 QALLASPNPNDP-LANDVAEDWIKNEQGAKAKAREW 143 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.141 0.408 Gapped Lambda K H 0.267 0.0521 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,280,704 Number of extensions: 58478 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 167 Number of HSP's successfully gapped: 19 Length of query: 361 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 275 Effective length of database: 1,226,816 Effective search space: 337374400 Effective search space used: 337374400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.7 bits)