RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str. psy62] (361 letters) >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* (A:99-339) Length = 241 Score = 29.5 bits (64), Expect = 0.76 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 IK +GF F + Y+I K ++F + + + H Sbjct: 9 IKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTH 43 >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3kc3_A* 2jbo_A* 2jbp_A* (A:108-336) Length = 229 Score = 28.6 bits (62), Expect = 1.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNY 268 I+ G Q F+E+ A+ +I + F + NI H Sbjct: 10 IQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRD 46 >2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} (C:1-68,C:250-284) Length = 103 Score = 28.0 bits (62), Expect = 1.7 Identities = 20/95 (21%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Query: 266 HNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM 325 H++ + YF + L+ A+ + +S+ L F +++ L+ + Sbjct: 10 HHHSSGENLYFQGHMRLLFSALLALLSSIILLF-------VLLPVAATVTLQLFNFDEFL 62 Query: 326 KSFGKSGILLPVAAALIPVILTISLSILILLQKED 360 K+ +PVAA LI + L + +++ I++ +ED Sbjct: 63 KAASDPSAAMPVAAILILLSLAVFVALRIIVGRED 97 >1ua2_A CAK, cell division protein kinase 7, TFIIH basal; cell cycle, phosphorylation, protein-protein interaction, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} (A:94-346) Length = 253 Score = 27.6 bits (59), Expect = 2.3 Identities = 2/29 (6%), Positives = 9/29 (31%) Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 + ++ + + ++ I H Sbjct: 14 LVLTPSHIKAYMLMTLQGLEYLHQHWILH 42 >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transferase; HET: STU; 2.70A {Homo sapiens} (A:142-400) Length = 259 Score = 27.7 bits (60), Expect = 2.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 I+ G Q F+E+ AS I + + + + NI H Sbjct: 9 IQDRGDQAFTEREASEIXKSIGEAIQYLHSINIAH 43 >3bqc_A Casein kinase II subunit alpha; protein kinase CK2, eukaryotic protein kinases, emodin, ATP-competitive inhibitor, ATP-binding, nucleotide-binding; HET: EMO; 1.50A {Homo sapiens} (A:123-335) Length = 213 Score = 27.6 bits (59), Expect = 2.6 Identities = 7/30 (23%), Positives = 14/30 (46%) Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 +Q ++ YEI+K + + + I H Sbjct: 3 YQTLTDYDIRFYMYEILKALDYCHSMGIMH 32 >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP- binding, cell division, disease mutation, kinase, nucleotide-binding; 3.00A {Homo sapiens} (A:102-308) Length = 207 Score = 27.0 bits (58), Expect = 4.2 Identities = 3/35 (8%), Positives = 11/35 (31%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 + + + ++ + F + + I H Sbjct: 8 LDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVH 42 >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... (A:83-298) Length = 216 Score = 26.8 bits (57), Expect = 4.7 Identities = 2/36 (5%), Positives = 12/36 (33%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHN 267 + +++++ ++F + + H Sbjct: 9 MDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHR 44 >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} (A:) Length = 152 Score = 26.0 bits (56), Expect = 8.6 Identities = 11/81 (13%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Query: 135 IQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-HIWEDFTSITIDKKNKIIHR 193 Q N D + D ++ + + K P + TS ID+ K++ + Sbjct: 62 FQVVAVNLDAKTGDAXKFLAQVPAEFTVAFDPKGQTPRLYGVKGXPTSFLIDRNGKVLLQ 121 Query: 194 KDADLAIIYNDKVK-LKKVVE 213 + + + Sbjct: 122 HVGFRPADKEALEQQILAALG 142 >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2exe_A (A:104-238,A:299-355) Length = 192 Score = 25.9 bits (56), Expect = 9.6 Identities = 6/35 (17%), Positives = 16/35 (45%) Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFH 266 +K + FQ + Y++ + F +++ + H Sbjct: 9 LKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTH 43 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.142 0.411 Gapped Lambda K H 0.267 0.0723 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,673,280 Number of extensions: 119898 Number of successful extensions: 488 Number of sequences better than 10.0: 1 Number of HSP's gapped: 486 Number of HSP's successfully gapped: 26 Length of query: 361 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 271 Effective length of database: 1,913,599 Effective search space: 518585329 Effective search space used: 518585329 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.0 bits)