255764470

255764470

integral membrane protein TerC

GeneID in NCBI database:8209401Locus tag:CLIBASIA_01500
Protein GI in NCBI database:255764470Protein Accession:YP_003064828.2
Gene range:-(318755, 320326)Protein Length:523aa
Gene description:integral membrane protein TerC
COG prediction:[P] Membrane protein TerC, possibly involved in tellurium resistance
KEGG prediction:integral membrane protein TerC
SEED prediction:CBS domain protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED7 TM-Helix
HMMTOP7 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI
cHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEEEEHHHEEEEcccccHHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHHHHHccccccHHHHccccEEccccccHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHccccccccccccEEEEccccEEEEEcccHHHHHHHHcccccccccccccHHHHHHHHHccccccccEEEEccEEEEEEEEcccEEEEEEEEEcccccc
ccHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEHHHHHEEEEHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHEHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHcEcccccEEEEEccccHHHHHHHHHHcccccEEEcccccccEEEEEEHHHHHHHHHccccccHHHHcccccEccccccHHHHHHHHHHccccEEEEEEccccEEEEEcHHHHHHHHHccccccccccccEEEcccccEEEcccccHHHHHHHcccccccccccHHHHHHHHHHHcccccccccEEEEccEEEEEEEccccEEEEEEEEEcccccc
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPlfflkglsfsgrDIVLILGGFFLLFKGTIELHErlegdgfdkkhkffspvSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGlhfdipkgylyaSIGFSGIIEFFNQVARRNReqlmspsrLRARTADAVLRLlggkpiqpqglnvkadvllptqhekhiiSDQEKDMVQSVLTladrpaksimtprteiVWLDVNCVDEDLQWKILElghsrfpvaqgsldsFIGIVSARDLLRDLLEEGSMnfkrsirkplvvhENISVLKLMERLRKSSQTFVMVLDEygvlegmitpANILEaiagdfpdeddqklditvgddgsltvdgWIDVRYASKLfgvnlvdeddrysTLAGFILWrlghlpqekeifTEMNLKFEIIRLeghnidrvkvsglqnlsi
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNReqlmspsrlrARTADAVLRLLggkpiqpqglnvKADVLLPTQHEKHIISDQEKDMVQSVLTLadrpaksimtprteivwLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMnfkrsirkplvvheNISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDItvgddgsltvdGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIrleghnidrvkvsglqnlsi
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLIlggffllfkgTIELHERLEGDGFDKKHKFFSPVSWqvivlqivildlvFSLDSVVTAIGMVQHFsvmaiavavsalmmmavsQPMIRYISRHTTVVilclgfllmigflliieglHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIEL********************WQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARR****************DA*******************************ISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKL*ITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGL*****
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPI***GLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQ****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI
MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLSI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target523 integral membrane protein TerC [Candidatus Liberibacter
254780426320 hemolysin protein [Candidatus Liberibacter asiatic 9e-09
>gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Back     alignment
 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 14/235 (5%)

Query: 286 IISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQG 345
           I S+ EK++  ++L         IM  R  I  ++      +      + G S  PV + 
Sbjct: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128

Query: 346 SLDSFIGIVSARDLLRDL------LEEGSMNFKRS----IRKPLVVHENISVLKLMERLR 395
           SLD+  G+V  RD++  +          ++N + S    I+  L V  ++ V  L+  ++
Sbjct: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188

Query: 396 KSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLD-ITVGDDGSLTVDGWIDV 454
           +S     +V+DE+G  +G+++  +I+  +  D   E   K   I+   D +  VD   D+
Sbjct: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248

Query: 455 RYASKLFG--VNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEG 507
              +K+ G   N +  +    +L G I   L  +P   E+  E+   FEI+ L+ 
Sbjct: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEI-PGFEIVILDA 302

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target523 integral membrane protein TerC [Candidatus Liberibacter
315122141522 integral membrane protein TerC [Candidatus Liberibacter 1 0.0
83594202522 integral membrane protein TerC [Rhodospirillum rubrum A 1 1e-163
332717041519 integral membrane protein TerC [Agrobacterium sp. H13-3 1 1e-156
15890628518 hypothetical protein Atu4355 [Agrobacterium tumefaciens 1 1e-151
310817079518 integral membrane protein TerC [Ketogulonicigenium vulg 1 1e-150
114330657520 integral membrane protein TerC [Nitrosomonas eutropha C 1 1e-149
30250159520 CBS domain-containing protein [Nitrosomonas europaea AT 1 1e-143
306843325522 integral membrane protein TerC [Brucella sp. BO2] Lengt 1 1e-141
254719375522 integral membrane protein TerC [Brucella sp. 83/13] Len 1 1e-141
153009182522 integral membrane protein TerC [Ochrobactrum anthropi A 1 1e-141
>gi|315122141|ref|YP_004062630.1| integral membrane protein TerC [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 522 Back     alignment and organism information
 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/522 (87%), Positives = 494/522 (94%), Gaps = 1/522 (0%)

Query: 1   MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQRGKALVFGLTFAMVTR 60
           MFF WIYDYYVWIGLATLI LELVLGIDNLIFITLL EKLPLAQRGKAL FGLTFAM+TR
Sbjct: 1   MFFGWIYDYYVWIGLATLIVLELVLGIDNLIFITLLAEKLPLAQRGKALFFGLTFAMITR 60

Query: 61  IALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKGTIELHERLEGDGFDKK 120
           IALLA++SYWIVM QQPLFF +GL+FSGRDIVL++GG FLLFKGTIELHERLEGD FDKK
Sbjct: 61  IALLATISYWIVMFQQPLFFFRGLAFSGRDIVLVIGGLFLLFKGTIELHERLEGDEFDKK 120

Query: 121 HKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAIAVAVSALMMMAVSQPMI 180
           HKFFSP+SWQ+IVLQIV+LD++FSLDSVVTAIGMV+ FSVMAIAV VSALMMMA S+PMI
Sbjct: 121 HKFFSPISWQIIVLQIVVLDVIFSLDSVVTAIGMVEDFSVMAIAVVVSALMMMAASKPMI 180

Query: 181 RYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASIGFSGIIEFFNQVARRNRE 240
           RYIS+HTTVVILCLGFLLMIGFLLIIEGLHF+IPKGYLYASI FSGIIEFFNQVARRNRE
Sbjct: 181 RYISQHTTVVILCLGFLLMIGFLLIIEGLHFEIPKGYLYASIAFSGIIEFFNQVARRNRE 240

Query: 241 QLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQHEKHIISDQEKDMVQSVLT 300
           +LMS SRLRAR ADAVLRLLGGKPIQP G    +DVL   +HEK IISDQEKDMVQSVLT
Sbjct: 241 RLMSTSRLRARAADAVLRLLGGKPIQP-GFKKNSDVLSFPKHEKQIISDQEKDMVQSVLT 299

Query: 301 LADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLL 360
           LADRPAKSIMTPRT+IVWLD++CVDEDLQ+KILELGHSRFP+AQG+LD+FIGIVSAR LL
Sbjct: 300 LADRPAKSIMTPRTDIVWLDMDCVDEDLQYKILELGHSRFPIAQGTLDNFIGIVSARGLL 359

Query: 361 RDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANI 420
           RDLLEEGS+N + SIRKPLVVHENISVLKLMERLRKS QTFVMVLDEYGVLEGMITPANI
Sbjct: 360 RDLLEEGSINLESSIRKPLVVHENISVLKLMERLRKSEQTFVMVLDEYGVLEGMITPANI 419

Query: 421 LEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYASKLFGVNLVDEDDRYSTLAGFIL 480
           LEAIAGDFPDEDDQKLDITVG+DGSLTVDGWIDVRYASKLFGV+LVDEDDRYSTLAGFIL
Sbjct: 420 LEAIAGDFPDEDDQKLDITVGEDGSLTVDGWIDVRYASKLFGVDLVDEDDRYSTLAGFIL 479

Query: 481 WRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSGLQNLS 522
           W+LGHLPQEKE+F EMN++FEIIRL+GHNIDRVKVSGLQNL+
Sbjct: 480 WKLGHLPQEKEVFMEMNIRFEIIRLQGHNIDRVKVSGLQNLN 521


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|83594202|ref|YP_427954.1| integral membrane protein TerC [Rhodospirillum rubrum ATCC 11170] Length = 522 Back     alignment and organism information
>gi|332717041|ref|YP_004444507.1| integral membrane protein TerC [Agrobacterium sp. H13-3] Length = 519 Back     alignment and organism information
>gi|15890628|ref|NP_356300.1| hypothetical protein Atu4355 [Agrobacterium tumefaciens str. C58] Length = 518 Back     alignment and organism information
>gi|310817079|ref|YP_003965043.1| integral membrane protein TerC [Ketogulonicigenium vulgare Y25] Length = 518 Back     alignment and organism information
>gi|114330657|ref|YP_746879.1| integral membrane protein TerC [Nitrosomonas eutropha C91] Length = 520 Back     alignment and organism information
>gi|30250159|ref|NP_842229.1| CBS domain-containing protein [Nitrosomonas europaea ATCC 19718] Length = 520 Back     alignment and organism information
>gi|306843325|ref|ZP_07475931.1| integral membrane protein TerC [Brucella sp. BO2] Length = 522 Back     alignment and organism information
>gi|254719375|ref|ZP_05181186.1| integral membrane protein TerC [Brucella sp. 83/13] Length = 522 Back     alignment and organism information
>gi|153009182|ref|YP_001370397.1| integral membrane protein TerC [Ochrobactrum anthropi ATCC 49188] Length = 522 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target523 integral membrane protein TerC [Candidatus Liberibacter
COG0861254 COG0861, TerC, Membrane protein TerC, possibly involved 5e-56
TIGR03716215 TIGR03716, R_switched_YkoY, integral membrane protein, 5e-10
COG4536423 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB 5e-34
COG4535293 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC 2e-30
TIGR03520408 TIGR03520, GldE, gliding motility-associated protein Gl 1e-25
PRK15094292 PRK15094, PRK15094, magnesium/cobalt efflux protein Cor 2e-21
PRK11573413 PRK11573, PRK11573, hypothetical protein; Provisional 3e-21
COG1253429 COG1253, TlyC, Hemolysins and related proteins containi 1e-56
pfam03741184 pfam03741, TerC, Integral membrane protein TerC family 3e-33
TIGR03717176 TIGR03717, R_switched_YjbE, integral membrane protein, 3e-11
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two 4e-22
COG2524294 COG2524, COG2524, Predicted transcriptional regulator, 8e-06
COG4109432 COG4109, COG4109, Predicted transcriptional regulator c 2e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 6e-05
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tan 1e-04
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after human 0.002
pfam0347180 pfam03471, CorC_HlyC, Transporter associated domain 9e-12
KOG2118498 KOG2118, KOG2118, KOG2118, Predicted membrane protein, 2e-05
pfam0057157 pfam00571, CBS, CBS domain 9e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 0.003
>gnl|CDD|31202 COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163428 TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family Back     alignment and domain information
>gnl|CDD|34183 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34182 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE Back     alignment and domain information
>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>gnl|CDD|183209 PRK11573, PRK11573, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|31445 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|146399 pfam03741, TerC, Integral membrane protein TerC family Back     alignment and domain information
>gnl|CDD|163429 TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family Back     alignment and domain information
>gnl|CDD|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|33866 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73096 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|146225 pfam03471, CorC_HlyC, Transporter associated domain Back     alignment and domain information
>gnl|CDD|37329 KOG2118, KOG2118, KOG2118, Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 523 integral membrane protein TerC [Candidatus Liberibacter
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 100.0
PRK11573413 hypothetical protein; Provisional 100.0
TIGR03520408 GldE gliding motility-associated protein GldE. Members 100.0
COG0861254 TerC Membrane protein TerC, possibly involved in tellur 100.0
COG2899346 Uncharacterized protein conserved in bacteria [Function 99.64
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic 100.0
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic 100.0
pfam03741184 TerC Integral membrane protein TerC family. This family 100.0
PRK10995222 multiple drug resistance protein MarC; Provisional 98.06
PRK11111214 hypothetical protein; Provisional 97.83
PRK10739197 putative dITP- and XTP- hydrolase; Provisional 97.69
COG2095203 MarC Multiple antibiotic transporter [Intracellular tra 96.87
pfam01914203 MarC MarC family integral membrane protein. Integral me 96.75
PRK11469206 hypothetical protein; Provisional 96.24
TIGR00427206 TIGR00427 conserved hypothetical protein TIGR00427; Int 96.15
COG1971190 Predicted membrane protein [Function unknown] 95.25
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 99.91
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 99.58
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 99.5
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 99.42
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 99.4
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 99.39
COG4109432 Predicted transcriptional regulator containing CBS doma 99.37
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 99.34
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 99.32
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 99.32
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 99.31
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 99.29
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 99.29
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 99.29
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 99.29
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 99.28
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 99.28
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 99.26
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 99.26
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 99.25
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 99.24
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 99.23
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 99.22
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 99.21
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 99.2
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 99.19
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 99.19
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 99.19
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 99.19
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 99.18
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 99.17
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 99.16
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 99.16
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 99.15
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 99.15
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 99.14
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 99.14
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 99.14
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 99.14
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 99.13
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 99.12
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 99.11
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 99.09
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 99.08
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 99.08
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 99.08
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 99.08
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 99.07
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 99.07
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 99.06
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 99.06
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 99.05
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 99.02
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 99.01
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 99.01
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 98.99
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 98.98
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 98.98
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 98.97
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 98.94
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 98.84
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 98.79
COG3620187 Predicted transcriptional regulator with C-terminal CBS 98.75
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 98.75
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 98.59
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 98.52
COG0517117 FOG: CBS domain [General function prediction only] 98.44
KOG1764381 consensus 98.1
COG2905 610 Predicted signal-transduction protein containing cAMP-b 98.05
KOG0474762 consensus 97.96
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 97.82
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 97.6
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 97.49
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, is a 97.29
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 97.28
COG4175386 ProV ABC-type proline/glycine betaine transport system, 96.9
KOG1764381 consensus 96.68
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.68
TIGR01303 476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 95.34
pfam04332294 DUF475 Protein of unknown function (DUF475). Predicted 99.66
KOG2118498 consensus 99.64
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 99.25
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 99.04
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 98.92
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 98.75
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 98.72
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 98.65
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 98.51
KOG2550 503 consensus 97.08
TIGR00400 460 mgtE magnesium transporter; InterPro: IPR006669 This is 96.46
pfam0347180 CorC_HlyC Transporter associated domain. This small dom 99.63
PRK05326563 potassium/proton antiporter; Reviewed 97.87
COG3263574 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C- 96.87
COG3448382 CBS-domain-containing membrane protein [Signal transduc 99.3
COG2524294 Predicted transcriptional regulator, contains C-termina 99.02
KOG0475696 consensus 97.67
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 98.82
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 98.58
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 98.32
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 98.0
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 97.89
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 97.84
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 97.73
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 97.7
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 97.68
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 97.65
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 97.6
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 97.58
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 97.56
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 97.55
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 97.48
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 97.47
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 97.44
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 97.43
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 97.42
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 97.4
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 97.38
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 97.38
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 97.37
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 97.34
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 97.32
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 97.3
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 97.21
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 96.95
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 96.93
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 96.68
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 97.96
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 97.89
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 97.87
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 97.86
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 97.84
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 97.75
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 97.75
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 97.72
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 97.7
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 97.69
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 97.67
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 97.65
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 97.64
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 97.62
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 97.57
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 97.53
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 97.49
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 97.48
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 97.48
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 97.44
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 97.43
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 97.37
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 97.29
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 97.22
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.17
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 97.15
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 97.07
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 97.06
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 97.03
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 96.74
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 96.73
COG0517117 FOG: CBS domain [General function prediction only] 95.69
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 95.64
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 95.6
COG3448382 CBS-domain-containing membrane protein [Signal transduc 95.05
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 93.7
KOG2550 503 consensus 92.33
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 97.93
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 97.78
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 97.77
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 97.72
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 97.63
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 97.62
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 97.62
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 97.6
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 97.54
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 97.53
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 97.5
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 97.46
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 97.41
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 97.39
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 97.21
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 95.41
pfam01595182 DUF21 Domain of unknown function DUF21. This transmembr 97.43
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 97.24
COG2905 610 Predicted signal-transduction protein containing cAMP-b 96.98
PRK10229206 threonine efflux system; Provisional 96.01
PRK10520205 rhtB homoserine/homoserine lactone efflux protein; Prov 92.53
pfam01810191 LysE LysE type translocator. This family consists of va 90.68
pfam03741184 TerC Integral membrane protein TerC family. This family 95.92
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.73
COG2524294 Predicted transcriptional regulator, contains C-termina 95.36
COG0861254 TerC Membrane protein TerC, possibly involved in tellur 94.88
PRK10062303 hypothetical protein; Provisional 91.48
pfam05661293 DUF808 Protein of unknown function (DUF808). This famil 90.92
COG4109432 Predicted transcriptional regulator containing CBS doma 94.34
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>COG0861 TerC Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2899 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam03741 TerC Integral membrane protein TerC family Back     alignment and domain information
>PRK10995 multiple drug resistance protein MarC; Provisional Back     alignment and domain information
>PRK11111 hypothetical protein; Provisional Back     alignment and domain information
>PRK10739 putative dITP- and XTP- hydrolase; Provisional Back     alignment and domain information
>COG2095 MarC Multiple antibiotic transporter [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam01914 MarC MarC family integral membrane protein Back     alignment and domain information
>PRK11469 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00427 TIGR00427 conserved hypothetical protein TIGR00427; InterPro: IPR002771 Members of this family are integral membrane proteins that includes the antibiotic resistance protein MarC Back     alignment and domain information
>COG1971 Predicted membrane protein [Function unknown] Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>KOG1764 consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0474 consensus Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857 This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1764 consensus Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro: IPR005991 This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria Back     alignment and domain information
>pfam04332 DUF475 Protein of unknown function (DUF475) Back     alignment and domain information
>KOG2118 consensus Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>KOG2550 consensus Back     alignment and domain information
>TIGR00400 mgtE magnesium transporter; InterPro: IPR006669 This is the MgtE family of magnesium transporters Back     alignment and domain information
>pfam03471 CorC_HlyC Transporter associated domain Back     alignment and domain information
>PRK05326 potassium/proton antiporter; Reviewed Back     alignment and domain information
>COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>KOG0475 consensus Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>pfam00571 CBS CBS domain Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_p