HHsearch alignment for GI: 255764470 and conserved domain: cd04599

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=97.29  E-value=0.0004  Score=49.17  Aligned_cols=57  Identities=19%  Similarity=0.256  Sum_probs=45.5

Q ss_pred             CCCEEEEEEEEECCEEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCCEEEEEEHHHHHH
Q ss_conf             3786674653400028996089998999999985799788887678552788888888762
Q gi|255764470|r  301 LADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLR  361 (523)
Q Consensus       301 L~e~~V~~IMtPR~~i~~ld~~~s~~e~~~~i~~~~~SR~PV~~~~~D~iiGiv~~kDLl~  361 (523)
T Consensus        48 ~~~~~v~~iMt--~~~itv~~~~~l~~a~~~M~~~~i~~lpVvd~--g~lvGiiT~~Divr  104 (105)
T cd04599          48 HPNRLVADAMT--REVVTISPEASLLEAKRLMEEKKIERLPVLRE--RKLVGIITKGTIAL  104 (105)
T ss_pred             CCCCCHHHHCC--CCCEEECCCCCHHHHHHHHHHCCCCEEEEEEC--CEEEEEEECHHHCC
T ss_conf             88879688502--79899979491999999779859979999989--99999999458615