>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.06 E-value=4.4e-09 Score=85.38 Aligned_cols=105 Identities=17% Similarity=0.207 Sum_probs=89.4 Q ss_pred EEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCCEEEEEEHHHHHHHHHCCCCC----------HHH---HHHCCCEEEC Q ss_conf 899608999899999998579978888767855278888888876202024660----------168---8732743523 Q gi|255764470|r 316 IVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLEEGSM----------NFK---RSIRKPLVVH 382 (523) Q Consensus 316 i~~ld~~~s~~e~~~~i~~~~~SR~PV~~~~~D~iiGiv~~kDLl~~~~~~~~~----------~~~---~lir~~~~Vp 382 (523) T Consensus 3 fi~v~~~~sl~~a~~lm~~~~i~rlpVvd~~~g~lvGIiT~~dil~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~viti~ 82 (123) T cd04627 3 FIPVPSTASLFQAIEILGSGGIHRVAVTEEESGEVIGILSQRRLVEFLWENARSFPGLDPLYPIPLRDLTIGTSDVISIN 82 (123) T ss_pred CEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEHHHHHHHHHHCCCCCCCHHHHHCCCHHHHHCCCCCCEEEC T ss_conf 64848989299999999749977799995899949999997999999986376566144541120023323767717989 Q ss_pred CCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEEEHHHH Q ss_conf 89998999998850386277752286742565259999 Q gi|255764470|r 383 ENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANI 420 (523) Q Consensus 383 e~~~l~~lL~~fr~~~~~lAiVvDE~G~~~GIVTleDI 420 (523) T Consensus 83 ~d~~l~~A~~lM~~~~i~~lpVVD~~g~lvGiiS~~Dl 120 (123) T cd04627 83 GDQPLIDALHLMHNEGISSVAVVDNQGNLIGNISVTDV 120 (123) T ss_pred CCCCHHHHHHHHHHHCCCEEEEECCCCCEEEEEEHHHE T ss_conf 99959999999998098878698599969999892542

HHsearch alignment for GI: 255764470 and conserved domain: cd04627